KEGG   Rhodococcus opacus: ROP_00790Help
Entry
ROP_00790         CDS       T00882                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rop  Rhodococcus opacus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rop00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
70390..70986
Genome map
AA seq 198 aa AA seqDB search
MPSTATLHVLHQAPGRDLAAAEEAAAAFLDALGIDLDSESLRETPRRMAHGYAELFTPRA
FDLTTFPNDEDYDELVLVRNVPLRSVCEHHLLPFAGTVHIGYLPGDRIIGLSKLARVAEH
FACRPQVQERLTKQIAGWLDEHLHPRGVGVVIEAEHSCMTLRGVQSVGSATVTSALLGAL
RDDPRSRQEFFALAGVHA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgaccgcgacactccacgttctccaccaggcaccaggacgagacctggctgcg
gccgaagaggcggcagcggcgttcctggacgcactcgggatcgacctggactcggaaagc
ctgcgcgagacgccccggcgcatggcccacggctacgccgaactgttcaccccccgcgcc
ttcgatctgaccaccttccccaacgacgaggactacgacgagctcgtcctggtccgcaac
gtcccgctgcgatcggtgtgcgagcatcatctgctgccgttcgccggtaccgtccacatc
gggtatctgcccggcgaccgcatcatcggattgtccaagctcgcccgcgtggcagagcat
ttcgcctgccggcctcaagttcaggaacggctcaccaagcagatcgcgggctggctcgac
gaacatctgcatcctcggggtgtcggggtggtcatcgaggccgagcacagttgcatgacg
ctgcgcggggtgcaatcggtgggatcggccaccgtcacctccgctctgttgggagcgttg
cgcgatgatcctcgttcgcgccaggaattcttcgctctcgccggcgttcacgcctga

DBGET integrated database retrieval system