KEGG   Rhodococcus opacus: ROP_04010Help
Entry
ROP_04010         CDS       T00882                                 

Definition
hypothetical protein
Organism
rop  Rhodococcus opacus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
411582..412307
Genome map
AA seq 241 aa AA seqDB search
MTNDRSESPQSRPKPGGTRRRLPWLLAAAAVAVVGAVAIGAYVLTAGSDDARKAHDFAPS
ADNPDPSLGIEGIVTVDYPPADHVQAPQRVAYEESPPFGGAHDQYWATCTGIVYPEAIRA
ENAVHSLEHGAVWVTYDPDHLSADDVTALAAHVDGVPYTLMSPYPGLDSAVSLQSWGHQL
RLDDVHDQRIADFLTALRQNPNTYPEPGATCSTVRGGFDPADPPPFDPSAPGPDAVPVDG
N
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgaccgcagcgagagcccgcaatcccggccgaagccaggcgggacgcgacgg
cgtctgccctggctgctcgcggccgccgcggtggcggtggtgggggctgtcgccatcggt
gcgtatgtactgaccgccggatccgacgacgcccgaaaagcccacgacttcgcacccagc
gcggacaaccctgacccgtcattgggaatcgaggggatcgtcaccgtcgactatccgccc
gccgaccatgtgcaagcgccgcaacgagtggcgtacgaagagagtccgccgttcggtggt
gcacacgatcagtactgggcgacgtgcaccggaatcgtctatcccgaagcgatccgcgcc
gagaacgccgtacattccctcgaacacggggccgtgtgggtgacctacgacccggaccat
ctgagcgccgacgacgtcaccgcactggcggcgcacgtcgacggggtgccgtacaccctg
atgtcgccgtacccgggtctcgattcggcggtgtccctgcagtcgtggggtcaccaactc
cgactcgacgacgtccacgatcagaggatcgccgacttcctcacggctctacgacagaac
ccgaacacctacccggagcccggagcgacctgttcgacggtgcgcggcggattcgacccc
gccgacccgccgccgttcgatccgtccgcaccgggtccggatgcagttccggtggacggc
aactag

DBGET integrated database retrieval system