KEGG   Rhodococcus opacus B4: ROP_06340Help
Entry
ROP_06340         CDS       T00882                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rop  Rhodococcus opacus B4
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROP_06340 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ROP_06340 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    ROP_06340 (glcB)
Enzymes [BR:rop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ROP_06340 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
656358..658538
Genome map
AA seq 726 aa AA seqDB search
MTERVEVGGLQVAKVLYDFVNEEALPGTGIDVDGFWSGAVKVIEDLAPRNRSLLAVRDDL
QARIDTWHRDHTGTPDPAEYRQFLTSIGYLVPEPGPFAVSTANVDAEITSTAGPQLVVPV
LNARFALNAANARWGSLYDALYGTNAIGVDGGAEPGDSYNRVRGDRVIAWARNFLDTAAP
LRSGSHADAARYTVDGGALAVALADGTSTGLADPGKFVGYLGDPAAPSSVLLRNHGLHAE
IQIDPTSPIGQTDAAGVQDVVLESAVTTIMDFEDSVAAVDADDKVIGYRNWLGLNRGDLT
EELTKGGQAFTRRLNPDRTYTAPDGGELTLHGRSLLFVRNVGHLMSTPAILHPDGTEIPE
GILDALLTSLCAIHGLSRSEQTGPLDNSRTGSIYIVKPKQHGPDEVAFTTDLFGRVEQVL
NLPANTIKVGIMDEERRTTVNLAACIHEARERVVFINTGFLDRTGDEIHTSMEAGPMIRK
AEMKQQTWISAYEDWNVDIGLACGLQGRAQIGKGMWAMTELMAEMLEQKIGHPKAGANTA
WVPSPTGATLHATHYHQVDVFAVQDELKGTRRAGLDQILTIPLAPDTDWTEEQKQEELDN
NCQSILGYVVRWIDAGVGCSKVPDIHDVALMEDRATLRISSQLLANWIRHGVVTAEQVVA
SLQRMAPVVDRQNQGDPTYRPLAPDFDTNIAFQAAKELILDGTTQPSGYTEPILHRRRRE
YKAANA
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgtgttgaggtcggcggtctgcaggtcgcgaaggtgctctacgacttcgtg
aacgaggaggcgttgccggggaccgggatcgacgtcgacggtttctggtcgggtgcggtg
aaggtgatcgaggacctggccccgaggaaccggtcgctgctcgcggtgcgcgacgatctg
caggcgcggatcgacacctggcaccgcgaccacaccggcacccccgatccggcggagtac
cggcagttcctgacctcgatcgggtatttggtgccggagccgggcccgttcgcggtgtcc
acggcgaacgtggatgcggagatcacctccaccgccggcccgcagctggtggtcccggtc
ctcaacgcccgcttcgcgctgaacgccgccaacgcccgctgggggtcgctgtacgacgcc
ctgtacggcaccaacgccatcggcgtggacggcggcgccgagccgggcgactcctacaac
cgggtccgcggcgacagggtcatcgcctgggcccgcaatttcctcgacaccgccgccccc
ctgcggtcgggttcgcacgccgacgccgcccgctacaccgtcgacggcggcgccctggcc
gtggcactggccgacggcaccagcaccggactggccgacccgggtaagttcgtcggctac
ctcggcgacccggccgccccgtcgtcggtgctgctgcgcaaccacgggttgcacgccgaa
atccagatcgacccgacctccccgatcggtcagacggatgcggccggcgtccaggatgtg
gtgctcgagtccgcggtcaccaccatcatggacttcgaggactccgtcgccgccgtcgac
gccgacgacaaggtgatcggctaccgcaactggctcgggttgaaccgcggtgatctgacc
gaggagctgaccaagggcgggcaggcgttcacccgccgcctcaacccggaccgcacctac
accgcccccgacgggggcgagctcaccctgcacgggcggtcgctgctgttcgtccgcaac
gtcgggcacctgatgagcaccccggcgatcctgcacccggacggcaccgaaatcccggag
ggcatcctcgacgccctcctcacctcgctgtgcgcgatccacgggctgtcccggtccgag
cagaccgggccgttggacaactcccgcaccgggtcgatctacatcgtcaaacccaaacag
cacggccccgacgaggtcgcgttcaccaccgacctgttcggtcgcgtcgaacaggtcctg
aacctgcccgcgaacacgatcaaggtcgggatcatggacgaggaacggcgcaccaccgtc
aacctcgccgcctgcatccacgaagccagggagcgggtggtgttcatcaacaccgggttc
ctcgaccgcaccggcgacgagatccacacctcgatggaggccgggccgatgatccgcaag
gccgagatgaaacagcagacctggatcagcgcctacgaggactggaacgtcgatatcggc
ctggcctgcgggctgcaggggcgggcgcagatcggcaagggcatgtgggcgatgaccgaa
ctgatggccgagatgctcgagcagaagatcggccaccccaaggccggcgcgaacaccgcc
tgggtgccgtccccgaccggggccaccctgcacgccacccactaccaccaggtcgacgtg
ttcgccgtccaggacgaactgaagggcacccggcgggccggtctcgaccaaattttgacg
atccccctggccccggacaccgactggaccgaggaacagaagcaggaggaactcgacaac
aactgccagtccatcctcgggtacgtggtccggtggatcgacgccggtgtcggctgctcg
aaggtccccgacatccacgacgtcgcgctgatggaggaccgggcgaccctgcggatctcc
tcgcagttgctggcgaactggatccggcacggggtggtcaccgccgagcaggtcgtggcc
tcgctgcagcggatggcgccggtggtggaccggcagaaccagggcgaccccacctatcgg
ccgctggccccggacttcgacaccaacatcgcgttccaggccgcgaaggaactgatcctc
gacggcaccacacagccctcgggttacaccgagccgatcctgcaccgccgccgccgcgaa
tacaaagccgccaacgcctga

DBGET integrated database retrieval system