KEGG   Rhodococcus opacus B4: ROP_07380Help
Entry
ROP_07380         CDS       T00882                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rop  Rhodococcus opacus B4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ROP_07380 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ROP_07380 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ROP_07380 (trpA)
Enzymes [BR:rop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ROP_07380 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(776345..777148)
Genome map
AA seq 267 aa AA seqDB search
MSERLSRLAPTFAQCREEKRAALVGYLPAGFPTVPESIDVFKAMVESGCDIVEVGIAYSD
PVMDGPTIQAAAETALQNGVRVRDVFTVVEAIASVGGKAVVMTYWNPVLQYGVDKFARDL
ASAGGLGLITPNLIPEEAGEWIAASKEHDLDRIFLVAPSSTEERLAITLDASSGFVYAAS
TMGVTGARDAVSSMAPELTARIRAHSDIPVGVGLGVRSGAQAAEIAAYADAVIVGSALVT
AAESGLDAVRSLTEELAEGVRSATVAS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaacgactctcgcgcctcgccccgacgttcgcgcagtgccgcgaggagaagcgt
gccgcgctcgtcgggtacctcccggccgggttccccaccgtgccggaatccatcgacgtg
ttcaaggcgatggtcgaatccggttgcgacatcgtcgaggtcggcatcgcgtattccgac
ccggtgatggacggacccaccattcaggcggcggccgagacggcgctgcagaacggtgtc
cgggtgcgcgacgtgttcacggtcgtcgaggcgatcgcctccgtcggtgggaaggccgtc
gtgatgacgtactggaaccccgttctgcagtacggcgtcgacaagttcgcccgcgatctg
gcgagcgcaggcggcctcgggctgatcacccccaacctcatccccgaggaagccggcgag
tggatcgccgcgtcgaaggaacacgacctcgaccggatcttcctcgtcgcgccgtcgtcg
accgaggagcgtctcgcgatcaccctcgacgccagcagcgggttcgtctacgccgcgtcc
acgatgggcgtcaccggcgcccgtgacgccgtgtcgtcgatggcgcccgaactgacggcc
cgcatccgcgcccattcggacattccggtgggtgtcggactgggtgtccgctccggcgcg
caggccgccgagatcgccgcctacgccgacgcggtcatcgtcggatccgcgttggtcacc
gcggcggagagcggtctggacgcggtgcgttcgctgacggaggaactcgccgagggcgtt
cgctcggctaccgtggcgtcgtga

DBGET integrated database retrieval system