KEGG   Rhodococcus opacus B4: ROP_07390Help
Entry
ROP_07390         CDS       T00882                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rop  Rhodococcus opacus B4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ROP_07390 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ROP_07390 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ROP_07390 (trpB)
Enzymes [BR:rop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ROP_07390 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(777145..778464)
Genome map
AA seq 439 aa AA seqDB search
MTSRNQETVFKGGNLPTASAGIAERTTHDPDAGGHFGVYGGRHVPEALMAVIEEVTAEYE
KARGDESFLNELDRLQRDYTGRPSPIFEATRMSEFAGGARLILKREDLNHTGSHKINNVL
GQVLLAKRMGKTRIIAETGAGQHGVATATACALLGLECIIYMGAVDTERQALNVARMRLL
GSAVVSVESGSRTLKDAINEALRDWVTNAHNTYYCFGTAAGPHPFPTIVRDFQRVVGLET
RVQVQAATGRLPDAVTACVGGGSNAIGIFHAFLDDPSVRLVGYEAAGDGVETGRHAATFA
GGTPGAFQGAYSYLLQDEDGQTIESHSISAGLDYPGVGPEHALLKDIGRATYEPVTDSEA
MDALRLLSEREGIIPAIESAHAVAGALRLGRELGEGAIIVVSLSGRGDKDMDTAAKWFGL
FDPDDSTETTTTDKEGSAK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcacgtaatcaggaaaccgtcttcaagggtggcaatctgccgactgccagcgcc
ggaatcgccgagcgcacgacgcacgaccccgatgccggaggacacttcggcgtgtacggc
ggacggcacgtgccggaggccctgatggcggtgatcgaggaggtcaccgccgagtacgag
aaggcgcgcggagacgagtcgttcctgaacgaactcgaccgcctccagcgcgactacacc
ggccgtccgtccccgatcttcgaggcgacgcggatgagcgagttcgccggtggggcgcgg
ctgatcctcaagcgcgaagacctcaaccacaccggctcgcacaagatcaacaacgtgctc
gggcaggtgctgctcgccaagcgcatgggcaagacgcgcatcatcgcggaaaccggtgcc
ggccagcacggtgtggccaccgccacagcctgcgcgctcctcggcctggaatgcatcatc
tacatgggcgccgtcgacaccgagcggcaggcactgaacgtcgcccgcatgcggctgctc
ggatcggcggtggtgtcggtcgagtcggggtcgcggaccctgaaggacgcgatcaacgag
gcgctccgcgactgggtcaccaacgcccacaacacctactactgcttcggcaccgccgcc
ggaccgcacccgttcccgaccatcgtccgcgacttccagcgcgtcgtcggtctggagacg
cgtgtgcaggtgcaggcggcgacgggccggctgcccgacgccgtgacggcgtgcgtcggc
ggcggttccaacgccatcggcatcttccacgccttcctcgacgacccgtccgtgcggctg
gtcggctacgaggccgccggtgacggcgtcgaaaccggaaggcacgccgccacgttcgcg
ggaggcaccccgggcgcgttccagggcgcatactcgtacctgctgcaggacgaggacggc
cagaccatcgagtcgcactcgatctccgcgggcctcgactaccccggggtcggcccggaa
cacgcgctcctcaaggacatcggccgcgccacctacgaaccggtcaccgactcggaggcc
atggatgcgctccgactgctgtccgagcgcgagggcatcatcccggccatcgagtccgcc
cacgccgtcgccggcgcactgcgcctgggccgcgaactgggcgagggcgcgatcatcgtc
gtcagcctgtccgggcgcggcgacaaggacatggacacggcagccaaatggttcggactg
ttcgatccggacgactcgaccgagaccaccacgaccgacaaggaaggttcggccaagtga

DBGET integrated database retrieval system