KEGG   Rhodococcus opacus B4: ROP_07400Help
Entry
ROP_07400         CDS       T00882                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01130  Biosynthesis of antibiotics
rop01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ROP_07400 (trpC)
Enzymes [BR:rop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ROP_07400 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase
Motif
Other DBs
NCBI-ProteinID: BAH48987
NITE: ROP_07400
UniProt: C1AT55
Position
complement(778527..779336)
Genome map
AA seq 269 aa AA seqDB search
MTVLDSILDGVRADVAAREAVLDFAAVKAAAAAAPPALDAAAALLEPGIGVIAEVKRASP
SKGALADIADPAELAAAYQAGGARVISVLTEERRFQGSLADLDAVRRAVSIPILRKDFIV
GPYQIHEARAHGADMVLLIVAALEQDALASLIDRTESLGMTALVEVHTEEEANRAIEAGA
KVIGVNARNLKTLEVDKNTFGEIAPGLPTEIIKIAESGVRGTADLLAYAGAGADAVLVGE
GLVTSGDPRKAVADLVNAGAHPSCPKPSR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgactgttctcgactcgattctcgacggggtgcgcgccgacgtcgccgcccgcgaagcc
gtcctcgacttcgccgcagtcaaggctgctgccgccgcggcgccgccggccctcgatgcc
gcggccgccctgctcgagccgggcatcggagtcatcgccgaggtcaagcgcgccagcccc
tcgaagggtgcgctcgccgacatcgccgatcccgccgaactggccgccgcctaccaggcc
ggtggcgcccgcgtgatcagcgtgctcaccgaggaacgccggttccaggggtccctcgcg
gacctcgacgccgtccgccgcgcggtgagcatcccgatcctccgcaaggacttcatcgtc
gggccgtaccagatccacgaggcccgcgcgcacggcgccgacatggtgctgctcatcgtc
gccgccctcgagcaggacgcgctcgcgtcgctgatcgaccggacggagtcgctgggcatg
acggccctcgtcgaggtccacaccgaggaagaagcgaaccgggcgatcgaagcgggcgcc
aaggtcatcggtgtcaatgcgcgcaacctcaagacgctcgaggtcgacaagaacacgttc
ggcgagatcgctcccggactgcccaccgagatcatcaagatcgcggagtccggggtgcgc
ggcacggccgacctgctggcgtacgccggtgcgggagccgacgcggtactggtcggcgaa
ggcctcgtcaccagcggtgatccgcgcaaggcggtggccgatctggtcaacgccggcgcg
cacccgtcctgccccaagccgtcgcgctga

DBGET integrated database retrieval system