KEGG   Rhodococcus opacus: ROP_08210Help
Entry
ROP_08210         CDS       T00882                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rop  Rhodococcus opacus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rop00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rop00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(859291..860865)
Genome map
AA seq 524 aa AA seqDB search
MKVTDGLRPAQPVRTTVSALAALAGARVEAPSGTAEHVIVTGVDLRAQGIVEGDLFAALP
GARAHGAEFAADALDRGATAILTDEAGLALVSALGTDAPVLVHDDPRGVLGELSATIYGR
PSEKMQVIGITGTSGKTTTSYLVEGALNAAGRTTGLVGTIETRMSGRRVPSALTTPEAPQ
LHALFAVMLEQGIDTVVMEVSSHALSLGRVDGVRFDVGAFTNLSQDHLDFHRDFEDYFAA
KARLFAAESSVHAQHAVICVDDVWGRRMAEVARGAHSIVTTVATTPETGGAVWTAGPATV
SASGSQKFALTTAEGTTLDVELRLPGQYNVANASLAVALCAVLGVDPRDAVAGIAGVDVP
GRVQRIDRGQDFLAVVDYAHKPAAVEAVIATLREQARGRVAVVVGAGGDRDAGKRPLMGA
AAARGADLLIITDDNPRTEDPATIRAAIREGALGVPESERGQVWEVADRAKAIADAVGWA
QAGDVVLVAGKGHEIGQEIHGVKYPFDDRAVLGDAIERQVGGTR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcacagacggtcttcgccccgcccagccggtccgtaccacggtgagcgctctg
gcggcgctcgccggagcgagggtcgaggcacccagcggaaccgccgagcacgtcatcgtc
accggagtggatctgcgcgcccaagggatcgtcgagggtgatctgttcgcggcccttccc
ggggcgcgcgcgcacggcgcggagttcgccgccgacgctctcgaccgcggagcgaccgcg
atcctcaccgacgaggccggcctcgcactggtatccgcgctgggcaccgacgcaccggtg
ctcgtccacgacgacccgcgcggcgtgctcggtgagctgtcggccaccatctacggtcgg
ccctcggagaagatgcaggtcatcggtatcacgggaacgtcgggcaagaccaccacctcg
tatctcgtcgaaggcgccctcaacgcggccggccggacgaccggtctcgtgggcaccatc
gagacccggatgagtggccgccgggtgccgagcgccctgaccacccccgaggcgccgcaa
ctccacgcgctgttcgccgtgatgctcgagcaggggatcgacaccgtcgtcatggaggtg
tccagccacgcgctgtccctcggccgggtcgacggagtccgcttcgacgtcggcgcgttc
acgaacctgtcccaggaccacctggacttccaccgcgacttcgaggactacttcgccgcc
aaggcgcggctcttcgcggccgagtcgtccgtgcacgcgcagcacgccgtcatctgcgtc
gacgacgtgtggggccggcggatggccgaggtcgcgcgaggcgcgcattcgatcgtgacg
acggtcgcgaccacaccggagaccggcggcgcggtgtggacggcgggcccggcgacggtg
tcggcatccggctcgcagaagttcgcgctcaccaccgccgaaggaacgaccctcgacgtg
gaactccggctgccggggcagtacaacgtcgcgaacgcgtcgctcgccgtcgcgctgtgc
gccgtgctgggcgtcgatccgcgcgacgccgtcgcgggcatcgccggcgtcgacgtgccg
ggccgggtgcagcggatcgaccgcgggcaggacttcctcgccgtcgtcgactacgcgcac
aagcccgcggcggtcgaggccgtgatcgcgacattgcgcgagcaggcacgcggacgcgtc
gccgtcgtcgtgggagccgggggcgatcgtgacgcgggtaagcggcccctgatgggcgcc
gcggccgcacggggagccgacctgctcatcatcacggacgacaacccgcgtaccgaggat
ccggcgacgatcagggccgcgatccgcgagggcgccctcggggtgcccgaatccgagcgg
ggacaggtgtgggaagtagcggaccgagcgaaggcgatcgccgacgccgtcggctgggcg
caggcaggcgacgtggttctggtcgcaggcaagggacacgagatcggtcaggagatacac
ggggtgaagtacccatttgacgaccgcgccgtactgggcgacgcgatcgagcgacaggtc
ggaggaacgcgatga

DBGET integrated database retrieval system