KEGG   Rhodococcus opacus B4: ROP_08780Help
Entry
ROP_08780         CDS       T00882                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase (EC:2.3.1.-)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rop  Rhodococcus opacus B4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROP_08780
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ROP_08780
  Amino acid metabolism
   00310 Lysine degradation
    ROP_08780
Enzymes [BR:rop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ROP_08780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
920107..921906
Genome map
AA seq 599 aa AA seqDB search
MVHDHKSTKFNNPNTTVEESKDMAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLE
VSTDKVDTEIPSPVAGVLSKIVAQEDDTVEIGGELAVIGDAGEAPASDSAPAPAAEEPAA
EPAPAAEAPAAEAAPAASGGGSAEGTPVNMPELGESVTEGTVTRWLKAVGDEVAVDEPLV
EVSTDKVDTEIPSPVAGTLLEISAEEDDTVSVGGRLAVIGSGAPAAKPEPKPEPTPEPAK
PAQSPEPAKPEPAKSAPAPAAAPAASAPAPAAAAPAPAATSGDSTPYVTPLVRKLAADNG
VDLSSVTGTGVGGRIRKQDVLAAAEAKKAPAAAAAPAAAPAAAAAPAAASAGVRPELAHL
RGTTQKANRIRQITATKTRESLQTTAQLTQTFEVDVTRIAALRAQAKNTFLEREGVKLTF
LPFFAKAVVEALKSHPNINASYDEANKQITYYDAEHLGFAVDTEQGLLSPVVHNAGDLSL
AGLARAIADIAKRARSGGLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIV
KRPVVVTDESGSESIGVRSMCYLPLTYDHRLVDGADAGRFLTTIKQRLEQGAFEADLGL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggttcacgaccacaagtcgacaaaattcaacaacccgaacacaactgtcgaggagtca
aaagacatggccttctccgtccagatgccagcgcttggtgagagtgtcaccgagggaact
gtcacgcggtggctcaagcaggaaggagacacggtcgaagttgacgaacccttgctcgaa
gtctccacggacaaggtggacacggaaatcccgtctcccgtggccggcgttctcagcaag
atcgttgctcaggaagacgacaccgtcgaaatcggtggcgagcttgccgtgatcggcgac
gccggtgaggctcccgcttccgactccgcacccgcacccgccgccgaggagcccgccgct
gagccggctcccgccgcggaggcaccggccgcagaggccgcacccgcagcgtccggcggc
ggttccgccgagggcaccccggtgaacatgcccgaactgggcgagtccgtcaccgagggc
accgtcacccgctggctcaaggccgtcggcgacgaggtcgccgtggacgagccgctcgtc
gaggtgtccaccgacaaggtcgacacggagatcccgtcgcccgtcgcaggcacgctcctc
gagatcagcgcggaagaggacgacaccgtctccgtcggcggccggctcgccgtcatcggt
tcgggtgcgcccgccgccaagccggagccgaagcccgagcccacccccgagcccgcgaag
cccgctcagtccccggagccggcgaagcccgagcccgccaagagcgcaccggctccggcc
gccgcaccggcagcatccgcgcctgctcccgccgccgcggcacccgctcccgcagcaacg
tccggagacagcaccccgtacgtcaccccgctggtgcgcaagctcgccgcggacaacggc
gtcgacctgtcctcggtgacgggcaccggagtcggtggccgcatccgtaagcaggacgtt
ctcgctgccgccgaggccaagaaggccccggccgccgctgcagcgcccgctgccgcaccg
gccgccgccgctgctcccgccgccgcctccgccggggtccgccccgagctggcgcacctg
cgcggaaccacgcagaaggccaaccggattcgccagatcacggccacgaagacccgggag
tcgctgcagaccacggcgcagctcacccagaccttcgaggtcgacgtcacccggatcgcg
gctctgcgtgcgcaggccaagaacaccttcctcgagcgcgagggcgtcaagctgacgttc
ctcccgttcttcgcgaaggccgtcgtcgaggcgctgaagtcgcacccgaacatcaacgcc
agctacgacgaggcgaacaagcagatcacctactacgacgccgagcacctgggcttcgcg
gtcgacaccgagcagggtctgctgtctccggtcgtccacaacgccggcgacctgtcgctg
gccggcctggcccgcgcgatcgcggacatcgccaagcgcgcccgctccggtgggctcaag
ccggacgagctgtccgggggcacgttcacgatcacgaacatcggcagccagggcgccctg
ttcgacaccccgatcctcgtgccgccgcaggccgcgatgctcggaaccggtgcgatcgtc
aagcgtcccgtggtcgtgaccgacgagtccggcagtgagagcatcggcgtccgctcgatg
tgctacctgccgctcacctacgatcaccgtctcgtcgacggtgccgacgccggccgcttc
ctgaccacgatcaagcagcgtctggagcagggagcgttcgaggccgacctgggtctgtag

DBGET integrated database retrieval system