KEGG   Rhodococcus opacus B4: ROP_08780Help
Entry
ROP_08780         CDS       T00882                                 

Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.-)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rop  Rhodococcus opacus B4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROP_08780
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ROP_08780
  Amino acid metabolism
   00310 Lysine degradation
    ROP_08780
Enzymes [BR:rop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ROP_08780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
920107..921906
Genome map
AA seq 599 aa AA seqDB search
MVHDHKSTKFNNPNTTVEESKDMAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLE
VSTDKVDTEIPSPVAGVLSKIVAQEDDTVEIGGELAVIGDAGEAPASDSAPAPAAEEPAA
EPAPAAEAPAAEAAPAASGGGSAEGTPVNMPELGESVTEGTVTRWLKAVGDEVAVDEPLV
EVSTDKVDTEIPSPVAGTLLEISAEEDDTVSVGGRLAVIGSGAPAAKPEPKPEPTPEPAK
PAQSPEPAKPEPAKSAPAPAAAPAASAPAPAAAAPAPAATSGDSTPYVTPLVRKLAADNG
VDLSSVTGTGVGGRIRKQDVLAAAEAKKAPAAAAAPAAAPAAAAAPAAASAGVRPELAHL
RGTTQKANRIRQITATKTRESLQTTAQLTQTFEVDVTRIAALRAQAKNTFLEREGVKLTF
LPFFAKAVVEALKSHPNINASYDEANKQITYYDAEHLGFAVDTEQGLLSPVVHNAGDLSL
AGLARAIADIAKRARSGGLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIV
KRPVVVTDESGSESIGVRSMCYLPLTYDHRLVDGADAGRFLTTIKQRLEQGAFEADLGL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggttcacgaccacaagtcgacaaaattcaacaacccgaacacaactgtcgaggagtca
aaagacatggccttctccgtccagatgccagcgcttggtgagagtgtcaccgagggaact
gtcacgcggtggctcaagcaggaaggagacacggtcgaagttgacgaacccttgctcgaa
gtctccacggacaaggtggacacggaaatcccgtctcccgtggccggcgttctcagcaag
atcgttgctcaggaagacgacaccgtcgaaatcggtggcgagcttgccgtgatcggcgac
gccggtgaggctcccgcttccgactccgcacccgcacccgccgccgaggagcccgccgct
gagccggctcccgccgcggaggcaccggccgcagaggccgcacccgcagcgtccggcggc
ggttccgccgagggcaccccggtgaacatgcccgaactgggcgagtccgtcaccgagggc
accgtcacccgctggctcaaggccgtcggcgacgaggtcgccgtggacgagccgctcgtc
gaggtgtccaccgacaaggtcgacacggagatcccgtcgcccgtcgcaggcacgctcctc
gagatcagcgcggaagaggacgacaccgtctccgtcggcggccggctcgccgtcatcggt
tcgggtgcgcccgccgccaagccggagccgaagcccgagcccacccccgagcccgcgaag
cccgctcagtccccggagccggcgaagcccgagcccgccaagagcgcaccggctccggcc
gccgcaccggcagcatccgcgcctgctcccgccgccgcggcacccgctcccgcagcaacg
tccggagacagcaccccgtacgtcaccccgctggtgcgcaagctcgccgcggacaacggc
gtcgacctgtcctcggtgacgggcaccggagtcggtggccgcatccgtaagcaggacgtt
ctcgctgccgccgaggccaagaaggccccggccgccgctgcagcgcccgctgccgcaccg
gccgccgccgctgctcccgccgccgcctccgccggggtccgccccgagctggcgcacctg
cgcggaaccacgcagaaggccaaccggattcgccagatcacggccacgaagacccgggag
tcgctgcagaccacggcgcagctcacccagaccttcgaggtcgacgtcacccggatcgcg
gctctgcgtgcgcaggccaagaacaccttcctcgagcgcgagggcgtcaagctgacgttc
ctcccgttcttcgcgaaggccgtcgtcgaggcgctgaagtcgcacccgaacatcaacgcc
agctacgacgaggcgaacaagcagatcacctactacgacgccgagcacctgggcttcgcg
gtcgacaccgagcagggtctgctgtctccggtcgtccacaacgccggcgacctgtcgctg
gccggcctggcccgcgcgatcgcggacatcgccaagcgcgcccgctccggtgggctcaag
ccggacgagctgtccgggggcacgttcacgatcacgaacatcggcagccagggcgccctg
ttcgacaccccgatcctcgtgccgccgcaggccgcgatgctcggaaccggtgcgatcgtc
aagcgtcccgtggtcgtgaccgacgagtccggcagtgagagcatcggcgtccgctcgatg
tgctacctgccgctcacctacgatcaccgtctcgtcgacggtgccgacgccggccgcttc
ctgaccacgatcaagcagcgtctggagcagggagcgttcgaggccgacctgggtctgtag

DBGET integrated database retrieval system