KEGG   Rhodococcus opacus B4: ROP_09880Help
Entry
ROP_09880         CDS       T00882                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rop  Rhodococcus opacus B4
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ROP_09880
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ROP_09880
Enzymes [BR:rop01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     ROP_09880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1031150..1032640)
Genome map
AA seq 496 aa AA seqDB search
MSVDCPRFIRPRPLPEVLRRLGRSATLCGPGDAAVTGINQDSRLVRAGDMYAALPGRHRH
GIEFAAEAASRGAVAMLSDRTSDVLPTIVVGDPRRILGPLASWMYGDPSEAFDVYGVTGT
NGKTSTVYLLDAGLRAAGAVAGMMTGITVRGPGGSRSATRTTPEACELQQTLAAFAEQRI
GAVAMEVSSHGLALHRIDGTSFRVGVFTNLARDHLDFHPDMDAYFAAKARLFDPRHCAAA
AIGIDDEFGRRLAATVTVPRLTFSSRTTAADIHASGVHADEGGTSFTLHGAGDRISVRLR
LLGVHQVDNALAAIAALVVRGVDPGAAIAGIEDLDTVPGRLEAVDAGQPFFAFVDYMHNT
AGQRRLFPYLRSLTAGRVIAVVGATGERDPGKRAPLGATAARFADAVVVTDESPYSEDAQ
RLREDVARGARSGGNADVLVVPDRTEAIAAAVTLAGPGDVVVVAGRGHDRVQAYGPRRRV
FDDRIALHEALLRSLS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcgactgcccgcggttcatccggccgaggccgctgccggaggtgctgcgccgc
ctcggccggtcggcgaccctctgcgggccgggcgacgccgcggtgacggggatcaaccag
gattcgcgtctcgtccgggccggcgacatgtacgcggcgctgccggggcggcaccgtcac
gggatcgaattcgcggccgaagccgcgtcgcgcggtgcggtcgcgatgctcagcgaccgc
acgtcggacgttctgccgacgatcgtggtgggcgatccgcgccggattctcggtccgctg
gcgtcgtggatgtacggcgatccgtccgaggcgttcgacgtctacggggtgaccgggacg
aacgggaagaccagcaccgtgtatctgctggacgcgggactgcgcgcggccggggccgtc
gcaggcatgatgacgggaatcacggtccggggacccggcggttcacggtccgcgacccgg
acgacacccgaggcgtgcgaactccagcagacactcgcggcattcgccgaacagcggatc
ggggcggtcgcgatggaggtgtcgagccacggcctcgcactgcaccggatcgacgggacg
tccttccgggtgggggtgttcaccaatctcgcccgcgaccatctggacttccacccggac
atggacgcgtacttcgcggcgaaggccagattgttcgacccccggcactgcgcggcggcc
gccatcggcatcgacgacgaattcggacgccgactcgccgccaccgtgaccgtgccccgg
ctgacgttctcgtcgaggacgacggcggccgacatccacgcgtccggcgtgcacgcggac
gagggcggcacgtcgttcacgctgcacggcgccggggaccggatatcggtgcggctgcgg
ttgctcggcgtgcaccaggtggacaacgcgctcgccgcgatcgccgccctcgtcgttcgg
ggcgtggacccaggcgcggcgatcgccgggatcgaggatctcgacaccgtcccgggacgc
ctggaggccgtggacgcgggtcagccgtttttcgccttcgtcgactacatgcacaacact
gccgggcagcgacggctgtttccgtacctccgatcactgacggcgggccgggtcatcgcc
gtcgtcggggcgacgggggagcgcgaccccggcaagcgggccccgctcggcgcgacggcg
gcccgtttcgccgacgccgtcgtcgtcacggacgagagcccgtactcggaggacgcgcag
cgcctgcgcgaggacgtggcgcgcggagcacgcagcggcggcaacgcggacgtgctggtc
gtccccgaccgcaccgaggcgatcgcggccgcggtcaccctcgcaggccccggtgacgtg
gtggtggtcgcaggccgtgggcacgaccgggtccaggcctacggtccgcgccgacgcgtg
ttcgacgaccggatcgcgctccacgaggcactgctccgctccctgagctag

DBGET integrated database retrieval system