KEGG   Rhodococcus opacus B4: ROP_10170Help
Entry
ROP_10170         CDS       T00882                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rop  Rhodococcus opacus B4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROP_10170
   01230 Biosynthesis of amino acids
    ROP_10170
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROP_10170
  Energy metabolism
   00680 Methane metabolism
    ROP_10170
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ROP_10170
Enzymes [BR:rop01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ROP_10170
Exosome [BR:rop04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ROP_10170
  Exosomal proteins of melanoma cells
   ROP_10170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1061806..1062465)
Genome map
AA seq 219 aa AA seqDB search
MTDAPRAPRRLILLRHGQTEYNADNRMQGQLDTELSELGRSQARAAATALVGRRPISIVS
SDLRRAYDTAVEVGDNAGLPVQIDERLRETHLGDWQGLTHLDVDARAPGARAAWRGDATW
APPGGESRIDVARRSKPVVAELVEKHEDWAEKPVVLVAHGGLIAALTAALLDLPVDRWPV
LGGLGNTSWVQLSAYGNSDSLSWRLDVWNASASVASDVL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatgctccccgtgccccgcggcggttgatactgctccgccacggacagaccgag
tacaacgccgacaaccgcatgcagggccagctcgacaccgaactgtcggagctgggacgg
tcgcaggcgcgcgccgccgcgaccgcgctcgtcggtcggaggcctatctccatcgtgtcc
tccgatctgcggcgggcctacgacaccgccgtggaggtcggcgacaacgccggacttccg
gtgcagatcgacgaacgcctccgggagacgcatctcggcgactggcagggactcacgcac
ctcgacgtcgacgcgcgcgcacccggcgcccgcgccgcgtggcgcggggatgcgacgtgg
gcaccccccggcggcgagagccgcatcgacgtcgcccgccgcagcaagccggtggtcgcc
gaactggtcgagaagcacgaggactgggccgagaagccggtggtcctggtcgcccacggc
ggactgatcgccgcactgaccgccgccctgctggatctgcccgtcgaccgctggccggtg
ctgggcgggctgggcaacaccagctgggtgcagctgagtgcgtacgggaactccgattcg
ctcagctggcgcctcgacgtgtggaacgcttccgcgagtgtggccagtgacgtcctctga

DBGET integrated database retrieval system