KEGG   Rhodococcus opacus B4: ROP_10170Help
Entry
ROP_10170         CDS       T00882                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K22306  
glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
rop  Rhodococcus opacus B4
Brite
Enzymes [BR:rop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     ROP_10170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(1061806..1062465)
Genome map
AA seq 219 aa AA seqDB search
MTDAPRAPRRLILLRHGQTEYNADNRMQGQLDTELSELGRSQARAAATALVGRRPISIVS
SDLRRAYDTAVEVGDNAGLPVQIDERLRETHLGDWQGLTHLDVDARAPGARAAWRGDATW
APPGGESRIDVARRSKPVVAELVEKHEDWAEKPVVLVAHGGLIAALTAALLDLPVDRWPV
LGGLGNTSWVQLSAYGNSDSLSWRLDVWNASASVASDVL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatgctccccgtgccccgcggcggttgatactgctccgccacggacagaccgag
tacaacgccgacaaccgcatgcagggccagctcgacaccgaactgtcggagctgggacgg
tcgcaggcgcgcgccgccgcgaccgcgctcgtcggtcggaggcctatctccatcgtgtcc
tccgatctgcggcgggcctacgacaccgccgtggaggtcggcgacaacgccggacttccg
gtgcagatcgacgaacgcctccgggagacgcatctcggcgactggcagggactcacgcac
ctcgacgtcgacgcgcgcgcacccggcgcccgcgccgcgtggcgcggggatgcgacgtgg
gcaccccccggcggcgagagccgcatcgacgtcgcccgccgcagcaagccggtggtcgcc
gaactggtcgagaagcacgaggactgggccgagaagccggtggtcctggtcgcccacggc
ggactgatcgccgcactgaccgccgccctgctggatctgcccgtcgaccgctggccggtg
ctgggcgggctgggcaacaccagctgggtgcagctgagtgcgtacgggaactccgattcg
ctcagctggcgcctcgacgtgtggaacgcttccgcgagtgtggccagtgacgtcctctga

DBGET integrated database retrieval system