KEGG   Rhodococcus opacus B4: ROP_10170Help
Entry
ROP_10170         CDS       T00882                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rop  Rhodococcus opacus B4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROP_10170
   01230 Biosynthesis of amino acids
    ROP_10170
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROP_10170
  Energy metabolism
   00680 Methane metabolism
    ROP_10170
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ROP_10170
Enzymes [BR:rop01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ROP_10170
Exosome [BR:rop04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ROP_10170
  Exosomal proteins of melanoma cells
   ROP_10170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1061806..1062465)
Genome map
AA seq 219 aa AA seqDB search
MTDAPRAPRRLILLRHGQTEYNADNRMQGQLDTELSELGRSQARAAATALVGRRPISIVS
SDLRRAYDTAVEVGDNAGLPVQIDERLRETHLGDWQGLTHLDVDARAPGARAAWRGDATW
APPGGESRIDVARRSKPVVAELVEKHEDWAEKPVVLVAHGGLIAALTAALLDLPVDRWPV
LGGLGNTSWVQLSAYGNSDSLSWRLDVWNASASVASDVL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatgctccccgtgccccgcggcggttgatactgctccgccacggacagaccgag
tacaacgccgacaaccgcatgcagggccagctcgacaccgaactgtcggagctgggacgg
tcgcaggcgcgcgccgccgcgaccgcgctcgtcggtcggaggcctatctccatcgtgtcc
tccgatctgcggcgggcctacgacaccgccgtggaggtcggcgacaacgccggacttccg
gtgcagatcgacgaacgcctccgggagacgcatctcggcgactggcagggactcacgcac
ctcgacgtcgacgcgcgcgcacccggcgcccgcgccgcgtggcgcggggatgcgacgtgg
gcaccccccggcggcgagagccgcatcgacgtcgcccgccgcagcaagccggtggtcgcc
gaactggtcgagaagcacgaggactgggccgagaagccggtggtcctggtcgcccacggc
ggactgatcgccgcactgaccgccgccctgctggatctgcccgtcgaccgctggccggtg
ctgggcgggctgggcaacaccagctgggtgcagctgagtgcgtacgggaactccgattcg
ctcagctggcgcctcgacgtgtggaacgcttccgcgagtgtggccagtgacgtcctctga

DBGET integrated database retrieval system