KEGG   Rhodococcus opacus B4: ROP_10750Help
Entry
ROP_10750         CDS       T00882                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rop  Rhodococcus opacus B4
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROP_10750 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROP_10750 (glk)
   00052 Galactose metabolism
    ROP_10750 (glk)
   00500 Starch and sucrose metabolism
    ROP_10750 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ROP_10750 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ROP_10750 (glk)
   00524 Butirosin and neomycin biosynthesis
    ROP_10750 (glk)
Enzymes [BR:rop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ROP_10750 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1123768..1124751
Genome map
AA seq 327 aa AA seqDB search
MSTVASVPFSALTVGIDVGGTSIRACVVDDTGEVLDSVQAPTPQSAKALEDALDRAVREL
AGRHPVSAVGLAVAGFITPDLTTVRFAPHLPWKNVPVANDLSERLGLPVVLEHDANAAAW
AEHRFGAAAGGRNVVMVAIGTGIGAALLIDGTLYRGSHGVAPELGHLQVVPGGRPCACGK
RGCWERYCSGTALVDTAIELLAADPTSSTILAREVASDPGSLTGRRIASAARDGDPLAIR
TMEEFARWLGVGLAMVGDVYDPDLVVIAGGVSGSAPLFLDHARDVYATLATGSGHRPLAR
IRETQLGESAQRIGAATLARRSAPVSG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgtcgcctccgtgcctttctccgctctcaccgtcggcatcgacgtcggtggt
accagtatccgggcctgcgtggtcgacgacaccggcgaggtgctcgactccgtgcaggcg
cccaccccacaatcggcgaaggccctcgaggacgcgctcgaccgtgccgtccgtgaactc
gcgggccgccaccccgtgtcggccgtcgggctcgccgtggccggcttcatcacccccgac
ctcaccaccgtgcggttcgcgccgcacctgccgtggaagaacgttccggtcgccaacgac
ctcagcgagcggctcggactgccggtggtcctcgaacacgatgcaaacgccgcggcgtgg
gcggagcaccggttcggggccgccgccgggggtcgcaatgtggtgatggtcgcgatcggc
accggcatcggtgcggccctgctcatcgacggcacgctctatcggggcagccacggtgtc
gctcccgaactgggccacctgcaggtggtgccgggcggcagaccctgcgcctgcggcaag
cgggggtgctgggaacggtattgcagcggaaccgctctcgtggacacggccatcgaactc
ctcgccgccgacccgacgagttcgacgatcctcgcacgcgaggtggcgagcgatccagga
tcgctcaccggccgccggatcgcgagcgccgcgcgggacggcgacccgctcgccatccgc
acgatggaggaattcgcgcgctggctcggcgtcgggctcgccatggtcggcgacgtctac
gaccccgatctcgtcgtcatcgccggcggtgtcagcggctcggctccgctgttcctcgac
cacgcccgggacgtctacgccactctcgcaaccggttccgggcatcgccccctcgcccgc
atccgcgaaacccaactcggcgaatcggcccagcgcatcggggccgccaccctcgcgagg
cgttccgcgcccgtgagtggttga

DBGET integrated database retrieval system