KEGG   Rhodococcus opacus B4: ROP_10920Help
Entry
ROP_10920         CDS       T00882                                 

Gene name
rpiB
Definition
(GenBank) ribose-5-phosphate isomerase B
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00030  Pentose phosphate pathway
rop00051  Fructose and mannose metabolism
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01120  Microbial metabolism in diverse environments
rop01130  Biosynthesis of antibiotics
rop01200  Carbon metabolism
rop01230  Biosynthesis of amino acids
Module
rop_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rop_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ROP_10920 (rpiB)
   00051 Fructose and mannose metabolism
    ROP_10920 (rpiB)
Enzymes [BR:rop01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     ROP_10920 (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB
Motif
Other DBs
NCBI-ProteinID: BAH49339
NITE: ROP_10920
UniProt: C1AVQ9
Position
complement(1142905..1143378)
Genome map
AA seq 157 aa AA seqDB search
MRVYLGADHAGFERKNEIIEHLKAAGHETVDCGAHVYDALDDYPAFCIETARRVVADEGS
LGIVLGGSGNGEQIAANKVKGARCALAWSVETAQLARQHNNAQLIGLGGRMHSLEESLAI
VDAFLAAEWSNEERHQRRIDILSEFEKSGVAPALPEA
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtatacctgggtgccgaccatgccggattcgaacgtaagaacgagatcatcgaa
catctgaaggccgcgggccacgagaccgtcgactgcggcgctcacgtctacgacgctctc
gacgactaccccgccttctgcatcgagacggcccgtcgcgtcgtcgccgacgagggcagc
ctcgggatcgtgctgggcggcagcggcaacggcgagcagatcgccgcgaacaaggtgaag
ggtgcgcgatgcgccctggcgtggagcgtcgagaccgcgcagctggcccgccagcacaac
aacgctcagctgatcggcctcggcgggcgcatgcactccctcgaggagtccctcgcgatc
gtggacgcgttcctcgccgccgagtggtcgaacgaggagcgccaccagcgccgcatcgac
attctgtccgagttcgagaagtccggcgtggccccggccctgcccgaggcctga

DBGET integrated database retrieval system