KEGG   Rhodococcus opacus: ROP_11520Help
Entry
ROP_11520         CDS       T00882                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.- 3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rop  Rhodococcus opacus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:rop00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1209317..1209949
Genome map
AA seq 210 aa AA seqDB search
MTDNENTDARRALLVVDVQNDFCEGGSLAVEGGSAVAAAISRFLAGAEYDAVAATIDHHI
DPGHHFSEEPDYVDTWPVHCKSGTPGADFHPNLDRSGIESVFSKGEFSAAYSGFEGTNSD
GQTLEKWLRAARVTEVDVVGIATDHCVVATALDAVTAGFRTRVLLPLTAGVAPATVEAAV
AAMRAAGVRLVGRDPDASSDRVAISDVGPE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacaacgagaacaccgacgcccgacgggcactactcgtcgtcgacgtccagaac
gacttctgcgagggcggctccctcgccgtcgagggcggttccgcggtcgcggcggcgatc
agccgcttcctggccggggccgagtacgacgccgtcgccgccacaatcgaccaccacatc
gacccgggtcaccacttctccgaagaaccggattacgtcgacacgtggccggtgcactgc
aaatcgggaacacccggcgcggatttccacccgaatctcgatcggagcggcatcgagtcg
gtgttctccaagggcgagttctcggcggcgtactcgggcttcgagggcacgaactccgat
ggccagaccctggagaaatggctgcgtgcggccagggtcaccgaggtcgacgtcgtggga
atcgccaccgaccactgcgtggtcgcgacggcactcgacgccgtaaccgccggtttccgg
acgcgcgtgctccttcccctcaccgcgggcgtggcgcccgcgaccgtcgaggccgcggtc
gccgcgatgcgggccgccggagtgcgcctcgttggccgcgacccggacgcctcctcggac
cgcgtggcgatttctgacgtaggtcccgagtaa

DBGET integrated database retrieval system