KEGG   Rhodococcus opacus B4: ROP_11970Help
Entry
ROP_11970         CDS       T00882                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00260  Glycine, serine and threonine metabolism
rop00750  Vitamin B6 metabolism
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01120  Microbial metabolism in diverse environments
rop01230  Biosynthesis of amino acids
Module
rop_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ROP_11970 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ROP_11970 (thrC)
Enzymes [BR:rop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ROP_11970 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAH49444
NITE: ROP_11970
UniProt: C1AW14
Position
complement(1265753..1266835)
Genome map
AA seq 360 aa AA seqDB search
MTGTRNPVHTPWPGLIEAYRDRLAIGPNWKTVTLREGGTPLLPAGHLSEITGCDVYLKVE
GLNPTGSFKDRGMTMAVTDALARGQQAVLCASTGNTSASAAAYAAKAKMTCAVLVPQGKI
AMGKLAQAVMHGARIIQVQGNFDDCLELARKTTAEFPTIGLVNSVNPVRIEGQKTAAFEI
CDALGKAPDVHALPVGNAGNITAYWRGYSEYYADGLTSVKPRMLGVQAAGAAPLVHGAPV
KDPETIATAIRIGSPASWNGAVAAKEESHGAFRAATDDEILEAYRLIARTEGVFVEPASA
ASVAGLLAARKEGWLDSGLTVVCTVTGNGLKDPDTALAGMPEVQPIPVDPVAVASALELA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcacccgtaatcccgttcacaccccctggccggggctgatcgaggcttaccgc
gaccgcctcgccatcgggccgaactggaagacggtcaccctgcgcgagggcggcaccccg
ttgctgcccgccgggcacctctcggagatcaccggctgcgacgtctacctgaaggtcgag
gggctcaaccccaccggttcgttcaaggatcgcggcatgacgatggccgtgaccgatgcg
ctggcccgcggccagcaggccgtcctgtgcgcgtccacgggtaacacgtccgcttccgcg
gccgcgtacgccgccaaggcgaagatgacgtgcgccgtgctggtgccgcagggcaagatc
gcgatgggcaagctcgcgcaggccgtcatgcacggtgcgcggatcatccaggtgcagggc
aacttcgacgactgcctcgaactggcccgcaagaccaccgcggaattccccacgatcggg
ctcgtgaactcggtcaaccccgtccgcatcgagggtcagaagaccgcggcgttcgagatc
tgcgacgccctcggcaaggcccccgacgtgcacgccctcccggtcggcaacgccggcaac
atcaccgcctactggcgcgggtactccgagtactacgcggacggcctcaccagcgtgaag
ccccgcatgctcggcgtgcaggccgcgggcgcggcgccgctcgtccacggtgcgccggtg
aaggacccggagaccatcgcgaccgcgatccgcatcggctcgcccgcttcctggaacggc
gctgtcgccgccaaggaagagtcgcacggcgccttccgggccgccacggacgacgagatc
ctcgaggcgtaccggctgatcgccaggaccgaaggggtcttcgtcgaacccgcgtcggcc
gcgagcgtcgcgggcctgctcgccgcccgcaaggagggctggctggactccgggctgacc
gtcgtctgcacggtcaccggtaacggcctcaaggaccccgacacggcgttggcgggtatg
cctgaggtccaaccgatcccggtcgaccctgtcgctgtcgcctcggccctcgagctggcg
tag

DBGET integrated database retrieval system