KEGG   Rhodococcus opacus: ROP_12690Help
Entry
ROP_12690         CDS       T00882                                 

Definition
uricase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
rop  Rhodococcus opacus
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rop00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1343686..1344579
Genome map
AA seq 297 aa AA seqDB search
MSQIVLGQNQYGKAEVRLVKITRDTKRHEIEDVTVTSQLRGDLDAVHTAGDNAHVVATDT
QKNTVYAFARDGVGAIESFAMRLGKHFTGEFEWITGGRWEIEQYSWARIPVDGEGHDHSF
VRSSDERRNTVVTIDGDRTWVVSGLSNMVVLKSTGSEFRGYPKDKYTTLQETSDRILATS
VSARWRYLTTDVDFDKTFENVRSIMLEAFATTHSLALQQSLFQMGSAVLEAHPEIAEVKF
SMPNKHHFLVDLEPFGLDNPGEVFFAADRPYGLIEATVEREDAPDAGRAWDSVPGFC
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagccagatcgtgctcggccagaaccagtacggcaaggcggaagtccggttggtcaag
atcacccgggacaccaagcgacacgagatcgaagacgtcaccgtcacttcgcaattgcgc
ggagacctcgatgcggtacacaccgcaggcgacaacgcgcacgtcgtggccacggacacc
cagaagaacacggtgtacgcgttcgctcgcgacggcgtcggcgcgatcgagtcgttcgcg
atgcgactcggcaaacacttcaccggcgagttcgagtggatcacgggcggccgctgggag
atcgagcagtactcgtgggcgcggatcccggtcgacggcgagggccacgaccattccttc
gtccgatcgagcgacgagcggcggaacaccgtggtcaccatcgacggcgaccgcacgtgg
gtcgtgtccggcctcagcaacatggtggtgctgaagtccacgggttcggagtttcgcgga
tacccgaaggacaagtacacgaccctgcaggagacatccgaccggatcctcgccacctcg
gtcagtgcccgatggcggtacctcaccaccgacgtcgatttcgacaagacgttcgagaac
gtgcggtcgatcatgctggaggcgttcgccacaacccactcgctcgcgctgcagcagtcg
ctgttccagatgggttcggcggtcctcgaggcgcaccccgagatcgccgaggtgaagttc
tcgatgccgaacaaacaccacttcctggtcgatctggagccgttcggactcgacaacccc
ggcgaggtgttcttcgcggccgaccgcccctacgggttgatcgaggcgaccgtcgagcgt
gaggacgcacccgacgccggccgcgcctgggattccgttcccggattctgctag

DBGET integrated database retrieval system