KEGG   Rhodococcus opacus: ROP_12800Help
Entry
ROP_12800         CDS       T00882                                 

Gene name
bkdH
Definition
branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.3.1.-)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rop  Rhodococcus opacus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:rop01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rop00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rop00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rop00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1353690..1354931
Genome map
AA seq 413 aa AA seqDB search
MAQEFRLPDLGEGLTEAELVSWAVEVGQSIELNQVIGEVETAKALVELPSPYPGVVEELL
VVPGATVPVGTPIIRIATDAATGEPPARTPVLVGYGPEAAAESKRARRRPATAPETAYPD
GRRPDASPAARLAARERGIDLAVVAGTGPSGAVTRNDVESHTGSAEPSVPSERSDDSETV
QRETRTPIRGVRKQTAAAMVRSAFTAPHVTEFVTVDVTRSVELLGRLRDLPEFEGLSVTP
LSLVAKAMIVALRANPSLNASWDEENQEIVTKHYVNLGIAAATPRGLMVPNIKEAQSLSL
LELCRAITELTATARSGRADPVQLTGGTVSITNVGVFGVDAGTPILNPGEAAILCLGSVD
KRPWVHEDELAVRWVTTLSVSFDHRVVDGEQGSRFLSSVAAMLHDPASLLAHL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
ttggcacaggaatttcgcctacccgatctcggtgaggggctgacggaggccgaactggtc
tcctgggccgtcgaggtgggccagtcgatcgaactcaatcaggtgatcggcgaggtcgag
acggcgaaagccctcgtcgaattgccctcgccctacccgggtgtcgtggaggaactgctg
gttgtcccgggagcgacggtgccggtggggacgccgatcatccggatcgcgacggatgcg
gccaccggggagcctcccgcgcgcacgcccgtcctggtggggtacggacctgaagccgcc
gccgagagcaagcgcgcccggcggcgaccggcgaccgctccggagaccgcctacccggac
ggtcggcgccccgacgcgtcgccggccgcccggctcgcggcccgggaacgcgggatagac
ctcgcagtcgtcgcggggacgggaccgtccggcgcggtcacgaggaacgatgtggaatcc
cacacggggtcggccgagccgtccgtgccgtcggaacgttcggacgattcggagacggtg
cagcgcgagacccgcaccccgatccgcggtgtccggaagcagacggcggcggcgatggtc
cgcagcgcgttcacggccccgcacgtcaccgaattcgtgaccgtcgacgtcacgcgctcg
gtggaactcctcgggcgcctgcgggacctccccgaattcgaggggctgtcggtgaccccg
ctgagcctcgtcgcgaaggcgatgatcgtcgcgctgcgggcgaacccgagcctcaacgcc
tcgtgggacgaggagaaccaggagatcgtcaccaagcactacgtcaacctcggtatcgcc
gcggccacaccccgaggtctgatggtccccaacatcaaggaggcacagtcgctgagcctg
ctcgaattgtgccgggcgatcaccgaactgaccgcgaccgcgcgcagtggcagggccgat
cccgtgcagctcaccgggggcacggtgtcgatcaccaacgtcggggtgttcggcgtcgac
gcgggcacgcccatcctcaaccccggcgaggcggccatcctgtgcctcggcagcgtcgac
aagagaccgtgggtgcacgaggacgaactcgcggtgcgctgggtcaccacgttgagcgtg
tcgttcgatcaccgcgtggtcgacggcgagcaggggtcgaggttcctgtcgtccgtcgcg
gcgatgctgcacgatcccgcctcactgctcgcgcacctctga

DBGET integrated database retrieval system