KEGG   Rhodococcus opacus B4: ROP_15180Help
Entry
ROP_15180         CDS       T00882                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha chain (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
rop  Rhodococcus opacus B4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rop00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ROP_15180 (recD)
Enzymes [BR:rop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ROP_15180 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1613429..1615300)
Genome map
AA seq 623 aa AA seqDB search
MTEVQVAQRGKGMLRVFNEAGVLAAADVHVALRLSALGGESSEDVVLATALAVRAVRSGS
VCLDLTRIREVTVDEESEVDLDALPWPEDSTVVAALRRSPLVTGGPAGPLRPLRLVDTAE
GGLLYLDRYFRQEATIRRVLDERAVGYPLVDERSLREGLDELFRDQHDHTAPAPSPDRQR
IAAAVAATQWTSVVVGGPGTGKTHTVARLLALLTRQPGPGRRIALAAPTGKAAARLQESV
REQADALGLPPELNAMTLHRLLGWQRGRGARFRFNANNHLPYDVIVVDETSMVSLTMMCR
LLAAVRPDTRLVLVGDPDQLTSVDAGAVLADLVARPVSGTENPVLGRVVGADLDAADDPL
EAALSASERDRLRGGVVRLSRGRRFGGGIAKLAVAVRDGEEELVIDILRGGGAPEVSFHG
PEDLDALRADVVATAAAVTDSAESGDASAALQHSEKHRLLCAHREGPYGVQRWARQAMEW
IGETTGQRLDPDRWYPGQPLMVTANDHETKIYNGDTGVIVRRDDDELFAAFVRGTEPFLL
HPTHLSAVQTVYAMTIHRSQGSQYDTVSVVLPGAASSLLTRELLYTAITRARNHVRIIGT
EDAVRAGVQRRVLRASGLRRAIP
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggtgcaggtggcgcagcgcggcaaggggatgctgcgggtcttcaacgaggcc
ggtgtgctggccgccgcggacgtacacgtcgcgctgcggttgtcggcgctcggcggcgaa
tcctcggaagacgtcgtgctggcgaccgcgctggcggtgcgcgcggtccggtccggctcg
gtgtgcctggacctgacgcggatccgggaagtcaccgtcgacgaggaatccgaagtcgat
ctcgacgccctgccctggccggaagactcgactgtcgtcgcggcactgcgccggagcccg
ctggtcacgggtggtcccgcgggaccgctgcgcccgctgcggctcgtcgacacggccgag
ggcggactgctctacctcgaccggtacttccggcaggaggcgaccatccggcgggtactc
gacgagcgcgccgtcgggtatccgctcgtcgacgagcggtcgctgagggaggggctggac
gagttgttccgcgaccagcacgaccacacggcgccggctccgtcaccggatcggcaacgg
atcgccgccgccgtggccgccacccagtggacgtcggtggtggtcggcgggccgggaacg
ggcaagacccacaccgtcgcccggctgctggcgttgctgaccaggcagcccggaccgggc
cggcgtatcgcgctcgccgcccccaccgggaaggccgcggcacggctgcaggagtctgtg
cgcgagcaggccgacgcactcgggttgccacccgaactgaacgcgatgacgctgcatcgg
ctgctgggctggcagcgtggacgcggcgcccggttccgcttcaacgcgaacaatcacctg
ccgtatgacgtgatcgtggtcgacgagacgtcgatggtgtcgctgacgatgatgtgccgg
ctcctcgcggccgtccgccccgacactcggttggtgctcgtcggcgacccggatcagctg
acgtcggtcgacgcgggcgcggtcctcgccgatctcgtcgcgcggccggtgtcgggaacc
gagaatccggtgctcgggcgagtcgtcggggccgacctcgacgccgccgacgacccgctc
gaggccgcgttgagtgcgagcgaacgggacaggttgcggggcggagtggtccggctcagc
cgcggtcggcgtttcggcggcggtatcgcgaaactggctgtcgcggtgcgggacggcgag
gaagaactggtgatcgacattctgcgcggcggcggtgcccccgaggtgtcgttccacggt
cccgaagatctggacgcactgcgggcggacgtggtggcgacggccgccgcggtcacggat
tccgcggaatccggcgatgcctccgctgcgctacagcattcggagaaacaccggctgttg
tgcgcgcaccgggaaggtccgtacggagtgcagcggtgggcgcggcaggcgatggagtgg
atcggcgagacgacgggacagcgactggacccggatcgctggtatccgggtcagccgctg
atggtgactgccaatgaccacgagacgaagatctacaacggcgacaccggagtgatcgtg
cgtcgggacgacgacgaactcttcgccgcgttcgtgcggggcaccgaaccgttcctgttg
catccgacgcatctgtccgcggttcagacggtgtatgcgatgacgattcaccgcagtcag
ggcagccagtacgacacggtgtccgtggtgctgcccggtgcggcgtcgtcgctgctgacc
cgagaattgctgtacaccgcgattacccgggcgcggaaccacgtgcggatcatcgggacc
gaggatgcggtgcgggcgggagtgcaacgccgggtgctgcgagcgagtgggcttcggagg
gcgattccatag

DBGET integrated database retrieval system