KEGG   Rhodococcus opacus B4: ROP_19600Help
Entry
ROP_19600         CDS       T00882                                 

Definition
DNA glycosylase (EC:3.2.2.-)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rop  Rhodococcus opacus B4
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:rop00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    ROP_19600
Enzymes [BR:rop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     ROP_19600
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     ROP_19600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2096520..2097386)
Genome map
AA seq 288 aa AA seqDB search
MPELPEVEALAEFLRKHAVGAVVGRVDVAALSVLKTFDPPITALQGRDVTGAARFGKHLA
LDCSGLWLVTHLSRGGWLRWTDNPSVAPPKPGKGPLALRVHFFTPEGATPAFDLTEAGTK
KRLAVWLVHDPREVEGIARLGPDALAVTEPEFAALLSTTSARIKNALVDQSLLAGVGNAY
SDEILHTAKISPFATSRTLPEDQVHVLYDAMRSVLTDAVERSLGQDAARLKGEKRSGMRV
HARTGLPCPVCGDTVREVSFAEKSFQYCATCQTGGKVLADRRMSRLLK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctgcccgaggtggaggcgttagccgagttcctgcggaaacacgccgtggga
gcggtcgtcggccgggtggacgtggcggccctgagtgtgctgaagacgttcgaccccccg
atcaccgccctgcagggccgcgacgtcacgggtgccgcccggttcggcaagcacctcgca
ctcgactgctccgggttgtggctcgtcacccacctctcgcgtgggggctggctgcgctgg
accgacaatccgtctgttgcgcccccgaaaccgggcaagggcccgctcgcgctgcgggtg
cacttcttcaccccggagggggcgacgcccgcgttcgacctgaccgaggcgggcacgaag
aagcggctcgcggtgtggctggtgcacgaccctcgggaggtggaagggatagcgcggctc
gggcccgacgccctggccgtcaccgaacccgaattcgcggcgctgctgtccaccacgtcg
gcgcggatcaagaacgcactcgtcgaccagtcgctgctcgccggcgtgggcaacgcctac
tccgacgaaatcctgcacaccgcaaagatttccccgttcgcgacttcgcggaccctgccg
gaagaccaagtgcacgtgctgtacgacgcgatgcgttccgtgctcaccgacgccgtcgaa
aggtcgctcggccaggacgcggcgcggctgaagggcgagaagcgatccgggatgcgcgtc
cacgcccggaccggcctgccctgccccgtctgcggtgacaccgtccgggaagtgtcgttc
gcggagaagtcttttcagtactgcgcgacgtgtcagaccggaggcaaggtgctcgccgac
cgccggatgtcgcggctgctgaagtag

DBGET integrated database retrieval system