KEGG   Rhodococcus opacus B4: ROP_19990Help
Entry
ROP_19990         CDS       T00882                                 

Gene name
echA
Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rop  Rhodococcus opacus B4
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ROP_19990 (echA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ROP_19990 (echA)
   00650 Butanoate metabolism
    ROP_19990 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    ROP_19990 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ROP_19990 (echA)
   00310 Lysine degradation
    ROP_19990 (echA)
   00360 Phenylalanine metabolism
    ROP_19990 (echA)
   00380 Tryptophan metabolism
    ROP_19990 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ROP_19990 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ROP_19990 (echA)
   00281 Geraniol degradation
    ROP_19990 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ROP_19990 (echA)
   00627 Aminobenzoate degradation
    ROP_19990 (echA)
   00930 Caprolactam degradation
    ROP_19990 (echA)
Enzymes [BR:rop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ROP_19990 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2129577..2130338
Genome map
AA seq 253 aa AA seqDB search
MSVVLIEFADGVAVITLNRPEAKNAVDLEVAKALAAAIDEFEARPDLTVAILTGAGGTFC
AGMDLKAFSRGERPSLPGRGFGGLTEAPPTKPLIAAVEGWALAGGCELALSADLIVAARD
AKFGIPEVKRGLAAAAGGLLRLPKVLPYPIAMEMAITGDPLTAEVAHAHGLVNRLTEPGQ
ALDTARELAARVAANGPLAVRATKQVVAMSAAYTDPELFAGQRRFLDPVFASDDAQEGAR
AFAEKRPPVWRGR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtggttctcatcgaattcgccgacggcgtcgccgtcatcaccctgaaccgaccg
gaggcgaagaacgccgtcgacctcgaggtcgccaaggcgctcgccgccgcgatcgacgaa
ttcgaggcgcggcccgacctgacggtcgcgatcctcaccggcgccgggggaacgttctgc
gcgggcatggatctgaaggcgttcagccgcggcgaacggccgtcgctgcccggccgcgga
ttcggcggactcaccgaggccccgccgacgaagccgctgatcgccgccgtcgagggatgg
gcgctcgccggcggctgcgagttggcgctgtcggccgacctgatcgtcgcggctcgcgac
gcgaagttcgggatccccgaggtcaagcgcgggctcgccgccgccgcgggcgggctgctg
cggctgccgaaggtgctgccgtacccgatcgcgatggagatggcgatcaccggcgatccc
ctcaccgccgaggtcgcgcacgcgcacggactcgtcaaccggctcaccgagcccgggcag
gcactcgacaccgcccgcgaactggcggcgcgggtcgccgccaacggtcccctcgccgtc
cgggccaccaagcaggtcgtcgcgatgtcggccgcctacaccgatcccgaactgttcgcc
gggcaacgccgcttcctcgatccggtgttcgcctccgacgacgcccaggagggtgcgcgc
gcgttcgcggagaagcgcccgccggtgtggcgtggccgatag

DBGET integrated database retrieval system