KEGG   Rhodococcus opacus: ROP_24360Help
Entry
ROP_24360         CDS       T00882                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
rop  Rhodococcus opacus
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:rop00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2622616..2623056)
Genome map
AA seq 146 aa AA seqDB search
MVSPSNDKEQFVLDFFKGMGPDLESFKKTYRESLAEDVEWESVGFDHHPNLEDSLKYLDT
LAEQTGMAYCDINVINIGSAGDLVFTERVDTMYRSDGSKIMDFRVAGVLEVRDGKIHRYT
DYLDSLGTATQLQSLAQEMGHGAVGA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgcccagcaatgacaaggaacaattcgttctcgacttcttcaagggaatggga
cctgacctggagtcgttcaagaagacgtatcgcgagagccttgccgaagatgtcgagtgg
gagagcgtggggttcgaccaccaccccaacctggaggactccctgaagtacctcgacacg
ctcgccgagcagacggggatggcctactgcgacatcaatgtgatcaacatcggttcggcg
ggagacttggtcttcaccgagcgcgtcgacacgatgtaccggagcgacggatcgaagatc
atggacttccgggttgcgggtgttctcgaggtgcgagatggcaagattcatcgctacacc
gactacctcgacagtctgggcaccgcgacccagctacagtcgctggctcaggagatgggt
cacggagccgtcggcgcctga

DBGET integrated database retrieval system