KEGG   Rhodococcus opacus B4: ROP_25300Help
Entry
ROP_25300         CDS       T00882                                 

Gene name
fadB
Definition
fatty oxidation complex alpha subunit
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rop  Rhodococcus opacus B4
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROP_25300 (fadB)
   01212 Fatty acid metabolism
    ROP_25300 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ROP_25300 (fadB)
   00650 Butanoate metabolism
    ROP_25300 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ROP_25300 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ROP_25300 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ROP_25300 (fadB)
   00310 Lysine degradation
    ROP_25300 (fadB)
   00380 Tryptophan metabolism
    ROP_25300 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ROP_25300 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ROP_25300 (fadB)
   00281 Geraniol degradation
    ROP_25300 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    ROP_25300 (fadB)
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ROP_25300 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ROP_25300 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ROP_25300 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2719597..2721804)
Genome map
AA seq 735 aa AA seqDB search
MSHNPIIRWERDDDGIVVLTIDDPTQRVNTMNAGFVDALEAALDRIETERDTITGVVVTS
GKDTFFAGGDLNDLRDASKDRIDEFATFVDRNSALLRRLETIGRPVVAAVNGSALGGGLE
LALATHHRVALDGPRNYVGLPEVTLGLLPGAGGVVRSVRMLGVERALSELLLQGQRRTVR
SARELGIIDELVESRSELVAVSKKWIIANPDAAQPWDVKGYRIPGGTPGDRNEQLHSRLP
AIPALLRKQSKGANYPAPQNIVAAAVESTQIDFDNALRVEARYFLDLATGQVAKNMIQAF
FFDIQSVNGARGRSADRTPWRARKVVVLGAGMMGAGIAYECARAGIDVVLKDVTLEAAER
GKGYSHKLVDKQVAAGRTSKDKGEALLARITPTDRAEMADGADLVIEAVFEDPAVKAQVL
AEIEPYLADGALIGSNTSTLPITGLAENVPRPEDFIGLHFFSPVDRMPLLEIIKGEKTSA
DTLSRALDLAKQIAKTPIVVNDSRGFFTSRVIGTFINEALALLGEGVPATTIEQASSQAG
YPAPVLQLTDELNLELLRRVRDASMQAAQDAGQAWIGHPAEAVLDRMLSEFGRAGRLAGA
GFYEYDENRKRTRLWTGLSDAFGGANADIPFDDVVERLLFAEVIETVKCLDEGVLEAVPD
ANVGSILGIGFPGWTGGVLQFVDGYEGGVAGFVARARYLAETYSDRFTPPESLLQLTESG
TTLARFRSAELVGTP
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgagccacaacccgatcatccgctgggaacgtgacgacgacggaatcgtcgtgctcacg
atcgacgacccgactcagcgcgtcaacacgatgaatgccggcttcgtcgacgcgctcgag
gcagccctcgaccgcatcgagaccgaacgcgacaccatcaccggcgtcgtcgtcacgtcc
ggcaaggacaccttcttcgccggcggagatctcaacgatctccgggatgcatcgaaggac
cgcatcgacgagttcgcgacgttcgtcgaccggaacagtgcgctgctgcgccgcctcgag
acaatcggacggcccgtcgtcgcggcagtcaacggttcggcgctcggcggcggactcgaa
ctcgcgctggccacccaccatcgcgtcgcactggacggtccgcggaactacgtcggactg
cccgaagtgaccctcggcctgctgcccggcgccggcggcgtcgtgcgctcggtgcggatg
ctcggcgtggaacgtgcgctctcggaactccttctgcaggggcaacgtcgcaccgtccgg
tcggcacgtgaactcgggatcatcgacgagctcgtcgagtcgcggtcggaactggttgcc
gtgtcgaagaaatggattatcgcgaacccggacgctgctcagccgtgggacgtgaagggc
taccgcattcccggcggaacacccggcgaccggaacgaacaactgcactcccgcctcccg
gcaatacccgctctactgcgcaaacagtcgaagggagcgaactacccggccccgcagaac
atcgtggcggcagcggtggagagtacccagatcgatttcgacaacgcgctgcgggtggag
gcccgttacttcctcgacctcgcgactgggcaggtcgccaagaacatgatccaggccttc
ttcttcgacatccaatcggtgaacggcgcccgcgggcgcagcgccgatcgcacgccctgg
cgcgcacgaaaggtcgttgtcctcggggcgggcatgatgggcgccggaatcgcatacgag
tgcgcccgcgccggcatcgacgtcgtcctgaaggacgtgacactcgaggccgccgaacga
ggcaagggatactcgcacaagctggtcgacaagcaggtcgctgcggggaggacctcgaag
gacaagggcgaggcacttctcgcccgcatcacgcccaccgaccgcgcggaaatggccgac
ggcgccgatctggtgatcgaggcagtgttcgaggatcccgccgtcaaagcccaggtgctc
gccgagatcgaaccgtacctcgccgacggcgccctcatcggatcgaacacgtccaccctg
cccatcacggggctggccgagaacgtcccccgacctgaagacttcatcggactccacttc
ttcagccccgtcgatcgcatgccgctgctggagatcatcaagggggagaagacctccgcc
gacacgctgtcgcgggcactggacctggcgaagcagatcgcgaagaccccgattgtcgtc
aacgacagccggggattcttcacgagccgcgtgatcggtacgttcatcaacgaggccctg
gcgttgctcggcgagggtgtcccggcgacgacgatcgaacaggccagttcgcaggccgga
tacccggctcccgtgctgcagctgaccgacgaactgaacctcgagctgctgcgtcgggtt
cgtgacgcgagcatgcaggccgcgcaagacgccggtcaggcctggatcggtcaccccgcc
gaggccgtgctcgaccgcatgctgtccgagttcgggcgggcaggccggctggccggagcc
ggattctacgaatacgacgagaatcgcaaacgtactcggctctggaccggtctgtcggat
gctttcggcggtgcgaatgccgacatcccgttcgacgatgtggtcgagcggctgttgttc
gccgaggtcatcgagaccgtgaagtgccttgacgagggagtcctcgaagcggttcccgac
gccaacgtcggctcgatcctcggtatcgggttccccggatggacgggcggagtcctgcag
ttcgtcgacggatacgagggcggtgtcgcgggcttcgtcgcccgagcccgatacctcgcc
gagacctacagcgaccgcttcacgccgcccgaatcacttctccagttgacggaatcgggc
acgacgctcgcacggttccgatccgccgaattggtcggcaccccctag

DBGET integrated database retrieval system