KEGG   Rhodococcus opacus B4: ROP_25310Help
Entry
ROP_25310         CDS       T00882                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA acyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rop  Rhodococcus opacus B4
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ROP_25310 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    ROP_25310 (fadA)
   00640 Propanoate metabolism
    ROP_25310 (fadA)
   00650 Butanoate metabolism
    ROP_25310 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    ROP_25310 (fadA)
   00072 Synthesis and degradation of ketone bodies
    ROP_25310 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ROP_25310 (fadA)
   00310 Lysine degradation
    ROP_25310 (fadA)
   00380 Tryptophan metabolism
    ROP_25310 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ROP_25310 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ROP_25310 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ROP_25310 (fadA)
Enzymes [BR:rop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ROP_25310 (fadA)
Exosome [BR:rop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ROP_25310 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(2721827..2723053)
Genome map
AA seq 408 aa AA seqDB search
MPATEALIFDAIRTPRGKGKPGGALHTVKPIDLTVGLIGDLLDRNPSLDSNRVDDLVLGV
VSPVGEQGGNVARTASIAAGLPDTVAGVQINRFCASGLEAVNIAAQKVRSGFEDLVFAGG
VESMSRVPMGSDGGAWMDDPATNLASHFVPQGVGADLIATIEGFTREDVDAYAVRSHQRA
SHAQKEGRFDHSTVPVRDLNGRVVLDTNEMIRPGTTVESLSGLRPSFAALGETAGFDAVA
LQKFYTVERIDHVHHAGNSSGIVDGASLLAIGSEEVGRELGLTPRGRIVATAVSGADPTI
MLTGPAPASWKALAKAGLTPADLDLVEINEAFASVVLRFVRDLDLDLDKVNVNGGAIAMG
HPLGATGGMIVSTLLDELHRTGGRYGLVTLCVGGGIGIATVIEALQAS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccggccactgaagcgctgatcttcgacgcgatccggacgccacggggtaagggaaag
ccgggcggcgctctgcacaccgtcaaaccgatcgatctgacagtcgggttgatcggtgat
ctccttgatcgcaatcccagcctggattcgaatcgtgtcgacgacctcgttctcggcgtc
gtctccccggtcggcgagcagggtggaaacgttgctcgcacagcgagtatcgctgccggg
ctgccggacacggtcgccggggtgcagatcaaccgcttctgcgcatcggggctcgaggcg
gtgaacatcgcagcgcagaaagtgcgttcggggttcgaggacctggtattcgcaggtggc
gtcgagtcgatgtcccgggtgcccatggggtccgacggcggcgcgtggatggacgatccg
gccaccaacctcgcgagccacttcgttccccagggtgtgggcgccgacctgatcgcaacg
atcgagggcttcacccgtgaggacgtcgacgcctacgccgtgcgttcacaccagcgcgcg
agccacgctcaaaaggagggccggttcgaccattcgaccgtccccgtccgagacctgaac
ggccgggtagtgctcgacaccaacgagatgatcaggccgggtacgacggtcgaatcgctg
agcgggctgcggccgtcgttcgccgcactgggcgagaccgcaggattcgatgcggttgcg
ctgcagaagttttacacggtcgagcgtatcgaccatgtccatcacgcgggcaacagctct
ggaatcgtcgacggcgcatccctgttggcgatcggaagcgaagaagtcggacgcgaactc
gggcttacaccgcggggacgtatcgtggcgaccgcggtgtccggcgccgatcccaccatc
atgctcaccgggcccgcccctgcctcgtggaaggcactggcaaaggctggactgacgccc
gccgacctcgacctggtcgagatcaacgaggcattcgcctcggtcgtcctacggttcgtc
cgcgatctcgacctcgatctcgacaaggtgaacgtcaacggcggcgccatcgcgatgggg
cacccgctcggcgccaccggaggcatgatcgtgtccaccctcctcgacgaactgcaccgc
accggcgggcgttacggcctcgtcaccctctgcgtgggcggtggcatcggcatcgccacc
gtgatcgaagcactccaggcaagctga

DBGET integrated database retrieval system