KEGG   Rhodococcus opacus B4: ROP_33330Help
Entry
ROP_33330         CDS       T00882                                 

Gene name
copB
Definition
copper-transporting ATPase CopB (EC:3.6.3.4)
Orthology
K01533  
Cu2+-exporting ATPase [EC:3.6.3.4]
Organism
rop  Rhodococcus opacus B4
Brite
Enzymes [BR:rop01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.4  Cu2+-exporting ATPase
     ROP_33330 (copB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3605325..3607379
Genome map
AA seq 684 aa AA seqDB search
MSHSPETREVPAAPKTHDKHAGHGAHGEVFRQKFWISLALSVPVVVFSHMFAELLGYSVP
DFPGASWIPPLVGTAIFFYGGAPFLTGAWRELKSRQPGMMLLIGMAITVAFLASWVTTLQ
IGGFNLDFWWELALLIVIMLLGHWLEMRALGSASGALDALAALLPDTADRITDDGVTEVP
VSELATGDLVLVRAGGRIPADGTVADGRAEVDESMITGESNPVPRSVGDPVVAGTVATDS
ALRITVGAVGEDTALAGIQRLVADAQSSSSRAQALADRAAAFLFYFASVAGLLTFVVWSL
LGNVDEAVVRTVTVLVIACPHALGLAIPLVIAISTERAARAGVLVKDRLALERMRGVDVV
LFDKTGTLTQGRHAVTGVVATAGVAETGLLALAAAVEADSEHPVARAIVAEAAAKVPAES
RRAASEFRSLPGRGVRAVVDGEEVSVGGPAMLGELHVKIPDDVAAQAKRWVDRGAAVLHV
VRGGTALGAVALEDAVREESRQAIDALHARGVKVAMITGDARQVADAVAADLGIDEAFAD
VLPENKDAEVAALQQRGHRVAMVGDGVNDAPALARADVGVAIGAGTDVAIESAGVVLAAD
DPRAVLSIIDLSQASYRKMWQNLVWATGYNIIAVPLAAGVVAFAGVAISPAVAAILMSIS
TIVVALNAQLLRRLNLDPERLARR
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacagcccggagacacgagaggtacccgccgcaccgaaaacccacgacaaacac
gccggccacggcgcgcacggcgaggtgttccggcagaagttctggatcagtctcgcactg
tcggtgccggtggtggtgttcagccacatgttcgccgaactcctcggctactcggtcccg
gactttcccggcgcgtcctggattccgccgctcgtcggcaccgcgatcttcttctacggc
ggcgcaccgtttctcaccggcgcgtggcgcgagctgaagtcgcggcagccgggcatgatg
ctgctgatcgggatggcgatcacggtcgcgttcctcgcctcgtgggtgacgaccctgcag
atcggcgggttcaacctcgacttctggtgggaactggcgcttctcatcgtgatcatgctg
ctcggtcactggctggagatgcgggcgctggggtcggcgtccggcgccctcgacgcgctc
gccgcgctgctcccggacaccgcggaccggatcaccgacgacggcgtcaccgaggtgccc
gtctccgaactcgccacgggcgacctggtgctggtgcgggccggtggccgcatccccgcg
gacggcaccgtcgcggacggccgcgcggaggtcgacgagtcgatgatcaccggcgaatcc
aatcccgtcccacggtcggtcggtgacccagtggtcgcgggcaccgtcgccaccgacagc
gcgctgcggatcaccgtcggcgccgtgggggaggacaccgccctcgcgggcatccagcgg
ttggtcgccgacgcgcaatcgtcctcgtcccgcgcgcaggccctcgccgaccgcgccgcg
gcgttcctgttctacttcgcctccgtcgcagggcttcttacgttcgtggtgtggtcgctg
ctcggcaacgtggacgaggccgtcgtccggaccgtgaccgttctggtgatcgcctgcccg
cacgccctcggcctggcgatacccctcgtgatcgccatttccaccgaacgcgccgcgagg
gccggtgtgctggtgaaggaccggctggcgctggagcgaatgcgcggcgtcgacgtcgtg
ctgttcgacaagaccggcaccctcacgcagggcaggcacgcggtgacgggcgtcgtcgcg
accgctggtgtcgccgagaccggcctgctcgcgctcgccgccgcggtcgaggccgacagc
gagcacccggtcgcccgcgcgatcgtcgccgaggccgccgcgaaggtgcccgccgagtcc
cgccgcgccgcgtccgagttccggtcgctgccgggtcgtggcgtccgggccgtggtcgac
ggtgaggaagtgtccgtcggcggaccggcgatgctcggcgaactgcacgtgaagattccc
gacgacgttgcagcgcaggcgaaaaggtgggtcgaccgcggcgccgccgtcctccacgtc
gtccgcggcgggacggcgctcggcgcggtggcgctcgaggacgccgtccgcgaggagtcc
cggcaggcgatcgacgccctgcacgcacggggcgtgaaggtcgcgatgatcaccggcgac
gcccggcaggtcgccgacgccgtcgccgccgacctcggaatcgacgaggcgttcgccgac
gtgctgccggagaacaaggacgcggaagtggctgcgctgcaacagcgtggtcatcgggtg
gcgatggtcggcgacggcgtcaacgacgcaccggccctcgcccgcgccgacgtgggtgtc
gccatcggggccggcaccgacgtcgccatcgaatcggcgggtgttgtcctcgccgccgac
gatccccgcgccgtgttgtcgatcatcgacctgtcgcaggcgagctaccgcaagatgtgg
cagaacctggtgtgggccaccggatacaacatcatcgccgtccccttggcggccggtgtc
gtcgcgttcgccggggtcgcgatctccccggcggtcgcggcgatcctgatgtcgatctcc
accatcgtggtcgcactcaacgcccagctgttgcgaagactaaatctggatccggaacgc
ttggcgcggaggtga

DBGET integrated database retrieval system