KEGG   Rhodococcus opacus B4: ROP_33600Help
Entry
ROP_33600         CDS       T00882                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00010  Glycolysis / Gluconeogenesis
rop00071  Fatty acid degradation
rop00350  Tyrosine metabolism
rop00625  Chloroalkane and chloroalkene degradation
rop00626  Naphthalene degradation
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01120  Microbial metabolism in diverse environments
rop01130  Biosynthesis of antibiotics
rop01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROP_33600 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    ROP_33600 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ROP_33600 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ROP_33600 (adh)
   00626 Naphthalene degradation
    ROP_33600 (adh)
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ROP_33600 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C NAD_binding_10 2-Hacid_dh_C Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: BAH51607
NITE: ROP_33600
UniProt: C1B7F4
Position
complement(3639383..3640396)
Genome map
AA seq 337 aa AA seqDB search
MPTHQAVHVQGPGEPLTLVEVETVSPPRDHVRIAVAACGVCGTDHGFVQGGFPDMSWPLT
PGHEIAGTIAEVGDGVDNYAVGDRVAVGWFGGHCTKCIPCRKGLFINCEKLQVPSWQYPG
GYAESVTAPANALARIPDELSFAEAAPMSCAGVTTYDALRKTRAVPGDRVAVLGVGGLGH
LGVQFARAMGFETIAIARGAHKGDDARDLGAHHYVDSTAGDVSDALQALGGVSVVLATAA
NSKAMGDTVGGLLPHGELIVVGVTPDPLPISPLQLITPGIDVTGHPSGTARDVEETMHFA
VLSGVRARIEERPLVQAAEAYAAMEEGKARYRMVLTM
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcctacccatcaggctgttcacgtccagggccccggcgaaccgttgacgctggtcgag
gtcgaaacggtgtcgcccccgcgcgaccatgtgcgcatcgccgtcgcggcgtgcggcgtg
tgcggcaccgaccacgggttcgttcaaggcgggttcccggacatgtcgtggccgctgaca
cccggtcacgagatcgccggaacgatcgccgaggtcggggacggtgtggacaactatgcc
gtcggtgaccgcgtggcggtgggctggttcgggggtcactgcaccaagtgcatcccctgc
cgcaagggattgttcatcaactgcgagaagttgcaggttccgagctggcagtacccgggc
ggctatgccgagtccgtgaccgcgccggccaatgcactggcccgtatccccgacgagctg
tccttcgcggaggccgcacccatgagctgcgccggggtcaccacgtacgacgcgctgcgc
aagaccagggcggtcccgggtgaccgcgtcgccgtcctcggtgtcggtgggctcggacac
ctcggtgtgcagttcgcccgggcgatgggattcgagacgattgccatcgcccggggcgcg
cacaagggcgacgacgcccgcgacctcggtgcgcaccactacgtcgactccactgccggc
gacgtcagcgacgcattgcaggcgctcggcggtgtctcggtcgtcctggcgacagcggcg
aactcgaaggccatgggtgacacggtcggcgggctgcttccccacggagaactcatcgtc
gtcggcgtcacgcccgacccgctgccgatcagcccgctgcagctgatcacccccggtatc
gacgtgaccggtcatccttccggcacggcccgcgacgtcgaggagacgatgcacttcgct
gtcctgtcgggggtgcgcgcccgaatcgaggaacgacccctggtccaggccgcggaggcc
tacgctgcgatggaggaagggaaggcacgctatcgcatggtcctcaccatgtga

DBGET integrated database retrieval system