KEGG   Rhodococcus opacus B4: ROP_34170Help
Entry
ROP_34170         CDS       T00882                                 

Gene name
cmtH
Definition
(GenBank) acetaldehyde dehydrogenase CmtH
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00360  Phenylalanine metabolism
rop00362  Benzoate degradation
rop00620  Pyruvate metabolism
rop00621  Dioxin degradation
rop00622  Xylene degradation
rop00650  Butanoate metabolism
rop01100  Metabolic pathways
rop01120  Microbial metabolism in diverse environments
rop01220  Degradation of aromatic compounds
Module
rop_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
rop_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ROP_34170 (cmtH)
   00650 Butanoate metabolism
    ROP_34170 (cmtH)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ROP_34170 (cmtH)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ROP_34170 (cmtH)
   00622 Xylene degradation
    ROP_34170 (cmtH)
   00621 Dioxin degradation
    ROP_34170 (cmtH)
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ROP_34170 (cmtH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DapB_N
Motif
Other DBs
NCBI-ProteinID: BAH51664
NITE: ROP_34170
UniProt: C1B7L1
Position
complement(3702027..3702992)
Genome map
AA seq 321 aa AA seqDB search
MTDKINVAIIGSGNIGTDLMIKVLRNSDILEMGAMVGIDPNSDGLARAARLNVPTTADGV
QGLIGLDNFAAIDIVFDATSAGAHRSNAAALAPYGKKLVDLTPASIGPYVVPPVNLEQHL
DGDVDNVNMVTCGGQATIPMVAAISAVTPVAYAEIVASIASKSAGPGTRANIDEFTETTS
HAIEQVGGAARGKAIIVLNPAEPPLLMRDTVLALIGDADHDAIRASITGMAARVAEYVPG
YRLKQDVQFTAIPDGEPVHTLLPDGTGPVTTKVSVFLEVEGAAHYLPAYAGNLDIMTSAA
LRTAESIARRIQNTIPAEVAP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagatcaatgtcgcgatcatcggatccggcaacatcggcaccgacctgatg
atcaaggtcctgcgcaactccgacatcctcgagatgggcgcgatggtcggcatcgacccg
aactccgacggcctcgcccgcgccgcccggctgaacgtcccgaccacggccgacggcgtc
cagggcctgatcggcctcgacaacttcgccgccatcgacatcgtcttcgacgccacctcc
gccggggctcatcggtccaacgccgccgccctcgccccctacggcaagaagctggtcgac
ctcacccccgcctcgatcggcccctacgtggtgccgccggtcaacctcgagcagcacctc
gacggcgacgtcgacaacgtcaacatggtcacctgcggcggtcaggccaccatcccgatg
gtcgcggccatctccgccgtcacccccgtcgcctacgccgagatcgtcgcgtccattgct
tcgaagtcggccggtcccggcacccgcgcgaacatcgacgaattcaccgaaaccacctcg
cacgccatcgaacaggtcggcggcgcggcccgcggcaaggcgatcatcgtcctcaatccc
gccgaaccacccctgctgatgcgcgacaccgtcctcgccctgatcggtgacgccgaccac
gacgccatccgtgcctcgatcaccggcatggccgcgcgcgtcgccgagtacgtccccggc
taccggctcaagcaggacgtccagttcaccgccatccccgacggagaacccgtccacacc
ctgctccccgacggcaccggcccggtcaccaccaaggtgtcggtgttcctcgaggtcgag
ggcgccgcccactacctgcccgcctacgccggcaacctcgacatcatgacctccgccgcc
ctgcgcaccgcggaatccatcgcccgacgcattcagaacacgatccccgcggaggtcgca
ccatga

DBGET integrated database retrieval system