KEGG   Rhodococcus opacus B4: ROP_36120Help
Entry
ROP_36120         CDS       T00882                                 

Definition
dihydrolipoamide acyltransferase (EC:2.3.1.-)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rop  Rhodococcus opacus B4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROP_36120
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ROP_36120
  Amino acid metabolism
   00310 Lysine degradation
    ROP_36120
Enzymes [BR:rop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ROP_36120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3908597..3909700)
Genome map
AA seq 367 aa AA seqDB search
MTTTQSGTTVALPSLGENVTEATITRWLKAPGEYVEFDEPLLEVATDKVDTEVPSPTAGI
LLEVLAAEDAVVEIGAALAVLGTDESAAAATPTPAPDPIPQPAPTPSPAPAPTPSPAPAP
APAVVPAAGGKRVEKLPRIRRTIARRMVESLQTSAQLTSVVEVDITAIARLRGREKEAFH
TRTGMKLSFLPFFVAAAVEALAEHPVINSSLDADCTEVTYHGSVHLGMAVDSDKGLMVPV
IRDAEGMSIPALTRAIADSADRVRTGTIRPDDLSGGTFTITNTGSRGALFDTPIINQPQS
AILGIGAVVERLVPTRGESGELRIEVKSMAYLSLSYDHRIVDGADAARYLTSVRQRLEAG
FAPSELQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgacccagagtggcaccacggtggcgctgccgtcgctcggtgaaaacgtcacc
gaggccacgatcacccgctggctcaaggcacccggcgagtacgtcgaattcgacgaaccc
ctcctcgaggtcgccaccgacaaggtcgacaccgaggtcccttccccgaccgccggcatc
ctcctcgaggtgctcgccgccgaggacgcggtcgtcgagatcggcgcggcactggcggtg
ctcggtaccgacgaaagcgccgccgcggccacgccgacccctgcaccggaccccatcccg
caacccgccccgacgccatcgccggcaccggccccgacgccatcgccggcaccggcaccg
gcaccggcggttgtgccggcagccggtggcaagcgggtggagaagctgccacggatccgc
cggaccatcgcccggaggatggtcgaatctctgcagacctcagcacaattgacctccgtc
gtcgaggtggatatcaccgcgatcgcccgcctgcgtggccgcgagaaggaggcgttccac
acgcggacagggatgaagctgtcgttcctgccgttcttcgttgccgccgccgtcgaagcc
ctcgccgagcacccggtgatcaactcctcgctcgacgccgactgcaccgaggtcacctac
cacgggtcggtgcacctcgggatggccgtcgacagcgacaaaggtctgatggtgccggtg
atccgcgacgccgaggggatgagcattcccgccctcacccgggcgatcgcggactccgcc
gaccgggtgcggacggggacgatccgcccggacgatttgtccgggggcacgttcaccatc
accaacaccggcagtcgcggggcgctgttcgacaccccgatcatcaaccagccgcaatcg
gcgatcctcgggatcggggccgtcgtcgaacgtctcgttcccacccgcggcgagagtggc
gaactccggatcgaagtgaagtcgatggcgtacctgtcgttgtcgtacgaccaccgcatc
gtggacggcgccgacgccgcccgctacctcacgtcggtgcggcagcgactagaagccggt
ttcgcgccttcggagttgcagtga

DBGET integrated database retrieval system