KEGG   Rhodococcus opacus B4: ROP_41320Help
Entry
ROP_41320         CDS       T00882                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00071  Fatty acid degradation
rop00280  Valine, leucine and isoleucine degradation
rop00281  Geraniol degradation
rop00310  Lysine degradation
rop00362  Benzoate degradation
rop00380  Tryptophan metabolism
rop00410  beta-Alanine metabolism
rop00640  Propanoate metabolism
rop00650  Butanoate metabolism
rop00903  Limonene and pinene degradation
rop00930  Caprolactam degradation
rop01040  Biosynthesis of unsaturated fatty acids
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01120  Microbial metabolism in diverse environments
rop01130  Biosynthesis of antibiotics
rop01200  Carbon metabolism
rop01212  Fatty acid metabolism
Module
rop_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ROP_41320 (fadB)
   00650 Butanoate metabolism
    ROP_41320 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ROP_41320 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ROP_41320 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ROP_41320 (fadB)
   00310 Lysine degradation
    ROP_41320 (fadB)
   00380 Tryptophan metabolism
    ROP_41320 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ROP_41320 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ROP_41320 (fadB)
   00281 Geraniol degradation
    ROP_41320 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ROP_41320 (fadB)
   00930 Caprolactam degradation
    ROP_41320 (fadB)
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ROP_41320 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ROP_41320 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ROP_41320 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAH52379
NITE: ROP_41320
UniProt: C1B9M6
Position
4432457..4434595
Genome map
AA seq 712 aa AA seqDB search
MSEQNIINWEQDADGIVVLTIDDPNQGANTMNDAYISSMKATVDRLVDEKDSITGVVITS
GKKTFFAGGDLKNMIKVGPENADEIYSHSVAIKSDLRRLETLGKPVVAAINGAALGGGLE
IALATHHRVAADVKGVKIGLPEVTLGLLPGGGGVVRTVRMLGLQNALMQVLLQGQQRGPV
QAKEVGLVDEVVASVEELVPAAKAWIKANPEGGVQPWDKKGYRIPGGTPSTPAFAANLPA
FPANLRKQLKGAPMPAPRAIMAAAVEGSQVDIDNALLIEARYFTSLVTGQVAKNMIQAFF
FDLQAINSGASRPEGIEKTPITKVGVLGAGMMGAGIAYVSAKAGFDVVLKDVTIEAANKG
KAYSEGIEAKALSRGKTTEEKSKALLDRITPSADPADFAGVDFVIEAVFESQDLKHKVFQ
EIEDIVDPKALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIRGEKTSDE
ALARVFDYVQAIRKTPIVVNDSRGFFTSRVIGTFINEAIAMLAEGIEPATIEQAGMQAGY
PAAPLQLSDELNLTLMQKIRKETAEAAKAEGKELPADPAGDVINTMVDKFDRKGKLGGAG
FYDYADGKRAGLWPGLRENFGSKELEVPFQDLIERMLFIEAIETQKCFDEGVLLTTADAN
IGSIMGIGFPAWTGGVSQYIQGYDGGRAGFVKRAEELAAKYGERFTPPASLK
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcagaacatcatcaactgggagcaggacgccgacggcatcgtcgtgctcacc
atcgacgatcccaaccagggcgcgaacaccatgaacgacgcctacatctcctcgatgaag
gcgaccgtcgaccgcctcgtcgacgagaaggactccatcaccggtgtcgtgatcacgtcc
ggcaagaagacgttcttcgccggcggcgatctgaagaacatgatcaaggtcggcccggag
aacgccgacgagatctacagccacagtgtcgcgatcaagtcggatctgcgccgcctcgag
acgctcggcaagcccgtcgtcgccgccatcaacggtgccgcgctcggtggcggactcgag
atcgcgctggccacgcaccaccgcgtcgccgcggatgtgaagggcgtcaagatcggcctg
cccgaggtcaccctcggcctgctgcccggcggcggtggcgtcgtccgcaccgtccgcatg
ctcggtctgcagaacgccctcatgcaggtgctgctccagggccagcagcggggaccggtg
caggccaaggaggtcggactcgtcgacgaggtcgtcgcctccgtcgaggaactggtgccc
gccgcgaaggcgtggatcaaggccaaccccgagggcggcgtccagccgtgggacaagaag
ggctaccggatccccggcggcaccccgtccaccccggcgttcgccgcgaacctgcccgcg
ttccccgcgaacctgcgcaagcagctgaagggcgcgcccatgccggcgccgcgcgccatc
atggccgctgccgtcgaggggtcgcaggtcgacatcgacaacgcgctcctcatcgaggcc
cgctacttcacgtcgctggtcaccggtcaggtcgcgaagaacatgatccaggcgttcttc
ttcgacctgcaggccatcaactccggggcgtcccgtcccgagggcatcgagaagaccccg
atcaccaaggtcggtgtgctcggcgccggcatgatgggcgccggaatcgcctacgtctcc
gcgaaagccggcttcgacgtcgtcctcaaggatgtcaccatcgaggccgccaacaagggc
aaggcgtactccgagggcatcgaggccaaggcgctgtcgcggggcaagaccaccgaggag
aagtcgaaggcgctcctcgaccgcatcacgccgtccgccgaccccgccgacttcgccggt
gtcgacttcgtcatcgaggccgtcttcgagtcgcaggacctcaagcacaaggtgttccag
gagatcgaagacatcgtcgacccgaaggcgctgctcggctcgaacacgtcgacgctgccg
atcaccggcctcgcgacgggtgtgaagcgccaagaggacttcatcggaatccatttcttc
tcgcccgtcgacaagatgccgctcgtcgagatcatccgcggcgagaagacatccgacgag
gccctcgcccgtgtcttcgactacgtgcaggccatccgcaagacgccgatcgtcgtcaac
gactcgcgcggcttcttcacctcccgcgtcatcggcacgttcatcaacgaggccatcgcc
atgctggcggagggcatcgagcccgccaccatcgaacaggcaggcatgcaggccggctac
ccggcggcaccgctgcagctgtccgacgagctgaacctcacgctgatgcagaagatccgc
aaggaaaccgcggaagccgcgaaggccgaaggcaaggaactgcccgccgacccggcaggc
gacgtcatcaacacgatggtcgacaagttcgaccgcaagggcaaactcggcggcgccggc
ttctacgactacgccgacggcaagcgcgccggcctgtggcccgggctgcgggagaacttc
ggttccaaggaactcgaagtgccgttccaggacctcatcgaacgcatgctgttcatcgag
gccatcgaaacgcagaagtgcttcgacgagggcgtgctcctcactactgccgacgccaac
atcggctccatcatgggtatcggcttccccgcctggaccggcggtgtgtcgcagtacatc
cagggctacgacggcggccgggccggcttcgtcaagcgcgccgaagaactcgccgccaag
tacggcgagcgcttcaccccgccggcgtcgctgaagtag

DBGET integrated database retrieval system