KEGG   Rhodococcus opacus B4: ROP_41380Help
Entry
ROP_41380         CDS       T00882                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rop  Rhodococcus opacus B4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rop00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ROP_41380 (recR)
DNA repair and recombination proteins [BR:rop03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ROP_41380 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4439718..4440326
Genome map
AA seq 202 aa AA seqDB search
MYEGPVQDLIDELGKLPGVGPKSAQRIAFHLLSVEPPEIDRLKNALQRVRDGVQFCVVCG
TVSDKEHCRICADPRRDRTVICVVEEPKDVQAVERTREFKGRYHVLGGALDPLSGVGPDQ
LRIRELLARIGNQEDGVDVSEVIIATDPNTEGEATATYLVRMLRDFPGLTVSRLASGLPM
GGDLEFADELTLGRALSGRRTL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggtccggttcaggatctgatcgacgagctgggcaaactgcccggcgtcggg
ccgaagagcgcgcagcgcatcgcgtttcacctgctcagtgtcgagccgccggagatcgac
cggctcaagaacgcgctgcaacgggtgcgtgacggcgtccagttctgcgtggtgtgcggc
acggtgtccgacaaggaacactgccgcatctgcgccgatccgcgccgggaccgcacggtg
atctgtgtggtcgaggagccgaaggacgtgcaggccgtggagcgcacccgcgagttcaag
ggccgctaccacgtcctcggcggcgcgctggacccgctgtccggggtgggcccggaccag
ctgcgtatccgggagttgctcgcgcgcatcggtaatcaggaggacggcgtcgacgtttcc
gaggtgatcatcgcgaccgaccccaacacggagggggaggccaccgcgacgtatctggtg
cggatgctgcgggacttccccggtctcacggtcagccggctcgcgtcggggctgccgatg
ggcggcgacctcgagttcgccgacgagctcacgctgggccgggcgttgtcggggaggcgc
acgctgtga

DBGET integrated database retrieval system