KEGG   Rhodococcus opacus B4: ROP_41910Help
Entry
ROP_41910         CDS       T00882                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rop  Rhodococcus opacus B4
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROP_41910 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROP_41910 (glk)
   00052 Galactose metabolism
    ROP_41910 (glk)
   00500 Starch and sucrose metabolism
    ROP_41910 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ROP_41910 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ROP_41910 (glk)
   00524 Butirosin and neomycin biosynthesis
    ROP_41910 (glk)
Enzymes [BR:rop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ROP_41910 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4512869..4513873
Genome map
AA seq 334 aa AA seqDB search
MGLTIGVDVGGTKIAAGVVDGDGVIHRMERRETPSHDARGVENAIAELVRELAATHPVQA
VGIGAAGFVAADLSTVLFAPNLAWRNEPLGEVVEAACGLPTVVENDANAAAWGEARFGAG
RTGQTVVVLTVGTGIGGGIVVDGVLHRGKFGVAAEFGHLNVEPHGRRCGCGNHGCWERYA
SGRALVREAQDLANVSPGFAADLLARAGGRADAITGLHVTAAAQDGDPAALECFRVIGSW
LGHGMADIAAFFDPDLFIIGGGVCEAGELLRGPAAAAFENRLTGRAHRPVAEVRLAELGA
NVGIVGAADLARERVLGFAHNGSRVSGGVQCPIG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgacgattggcgtcgacgtgggtggcacgaagatcgcggccggagtcgtggac
ggcgacggagtcatccaccggatggaacgccgggaaaccccgtcccacgacgcacggggg
gtggagaacgccattgccgaactcgttcgcgaactggcggcgacgcaccccgtgcaggcg
gtaggcatcggcgcggcaggcttcgtcgccgcggacctcagcaccgtgctcttcgccccg
aacctcgcctggcgcaacgaaccgctcggtgaggtggtcgaagcggcgtgcggtctgccg
acggtggtggagaacgacgccaacgccgcggcctggggcgaggcgcgcttcggggccggg
cggacgggacagaccgtcgtcgtgctcaccgtgggaaccggaatcggcggcggcatcgtc
gtcgacggcgtcctccaccgcggcaagttcggtgtggccgcggagttcgggcacctcaac
gtcgaaccgcacggtcgccggtgcggctgcggcaaccacggctgctgggagcgttacgcc
agcgggcgggcactcgtccgggaagcgcaggatctcgcgaacgtgtcgcccggtttcgcc
gccgacctcctcgcccgggcgggcggacgggcagacgccatcaccggcctgcacgtcacc
gccgccgcacaggacggcgaccccgctgcgctcgaatgtttccgggtgatcggttcctgg
ctggggcacggcatggcggacatcgccgcgttcttcgatcccgacctgttcatcatcggc
ggcggagtgtgtgaggccggtgaactgctgcgcggtcccgccgccgccgctttcgagaac
cgtctcaccggacgcgcacatcgaccggtcgccgaggtgcgactggcggaactcggcgcg
aacgtcggcatcgtcggcgccgccgatctggcccgggaacgagttctcgggttcgcacac
aacggctcacgagtatctggaggagtgcaatgtccaatcggttga

DBGET integrated database retrieval system