KEGG   Rhodococcus opacus B4: ROP_42140Help
Entry
ROP_42140         CDS       T00882                                 

Definition
oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
rop  Rhodococcus opacus B4
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    ROP_42140
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     ROP_42140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4540655..4542367
Genome map
AA seq 570 aa AA seqDB search
MTHYDVVVVGSGFGGSVAALRLTEKGYRVGVLEAGRRFADDELPETSWRLRRYLWAPWLG
CYGVQRIHLLPDVLVMAGAGVGGGSLNYANTLYQPPRRFFEDRQWAHITDWQAELAPYYE
QAKRMLGVTTNPSFTPADAVMREVAEEMGAGATFTSTPVGVFFGEPGARVADPFFGGQGP
DRTGCTECGSCMTGCRVGAKNTLVKNYLHLAEKAGARVHPLTTVKELRPRPGGGYELWTR
RTDGIRKREHTFTADQVVVAAGTYGTARLLLAMKESGALPRLSPRLGSVVRTNSEAVLAA
TARNRDTDFTKGVAITSSFHPDDHTHIEPVRYGKGSNAIGLLQTVLSDGGGRTPRLLKTV
GVALRRPGAFARSLSVRHWSERTVIALVMQTDDNSLELAKGKGRFGRAVTSRPGPGDPPP
EWIPQGHTAIRKVADRIGGDPGGSFADVVNIPMTAHFLGGCAIGDSPDTGVVDPYLRAYG
HDGLHVADGSVVSANLGVNPSLTITAQAERAFALWPNKGEKDTRPEPGKPYVRIAPSPPR
SPVVPAGAPGALRLPLTVVNRRETTDVERA
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgacgcactacgacgtggtcgtcgtcggctccggtttcggcggcagcgtcgcggcactc
cggctcaccgagaagggctaccgggtcggcgttctcgaggcaggcaggcgcttcgccgac
gacgaactgcccgaaacgagctggaggttgcggcgctacctgtgggcgccgtggctgggc
tgttacggcgtgcagcgaatccacctcctccccgacgtcctggtcatggccggggccggg
gtcggcggcggttcgctcaactacgcgaacacgctgtaccagccgccgcgccgattcttc
gaggaccggcagtgggcgcacatcaccgactggcaggcggagctggccccgtactacgag
caggcgaagcggatgctgggggtgacgaccaatccgtcgttcacccccgccgacgccgtc
atgcgcgaggtcgccgaggagatgggcgccggtgcgacgttcacgtccacaccggtgggt
gtcttcttcggcgaaccgggggcgcgggtggccgacccgttcttcggcgggcagggtccc
gaccggacggggtgcaccgagtgcggcagttgtatgacgggttgccgtgtgggagcgaag
aacacgctcgtcaagaattacctccatctcgcggagaaggcgggcgcccgggtccatccg
ctgacgacggtgaaggaattgcgaccccggcctggcggcggctacgagttgtggacccgc
cgcaccgacggaatccgcaagcgggagcacacgttcaccgccgaccaggtggtggtcgct
gccggcacgtacggtaccgcccggctgctgctggcgatgaaggaatccggtgcgctgcca
cggttgtcgccgcggctggggtcggtggtgcgcaccaactcggaggcggtgctcgcggcc
acggccaggaaccgcgacaccgacttcacaaagggcgtggccatcacgtcctcgttccac
ccggatgatcacacccacatcgagccggtgcggtacggcaagggcagcaacgcgatcgga
ctgttgcagaccgtcctcagcgacggcggcggccggacgccgcggttgctgaaaacggtc
ggcgtcgcgctgcgccgccccggggcgttcgcccgcagcctgtcggtgcggcactggtcg
gagcgcaccgttatcgcgctcgtgatgcagacggacgacaattcgctcgaactcgccaag
gggaagggtcggttcgggcgcgcggtcaccagccgtccggggcccggggatccgccgccc
gaatggatcccgcagggtcacacggcgatcaggaaggtggccgatcggatcgggggagac
ccgggcggttcgttcgccgacgtcgtcaacattccgatgaccgcgcatttcctcggggga
tgcgccatcggggactcgccggacaccggtgtcgtcgacccctacctgcgtgcatacggg
cacgatgggctgcacgtggccgacgggtcggtggtgagcgcgaacctcggcgtcaacccg
tcgctcaccatcaccgctcaggccgagcgcgcattcgcgctgtggcccaacaagggcgag
aaggacactcggcccgagcccggcaagccatacgtacgtatcgcaccgtcgccgccccgg
agtccggtggtgcccgccggcgcgcccggcgcgctgcggcttccactgacggtcgtgaac
cgaagggagacaaccgatgtggagcgtgcctga

DBGET integrated database retrieval system