KEGG   Rhodococcus opacus B4: ROP_43250Help
Entry
ROP_43250         CDS       T00882                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00790  Folate biosynthesis
rop01100  Metabolic pathways
Module
rop_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ROP_43250 (folP)
Enzymes [BR:rop01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ROP_43250 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: BAH52572
NITE: ROP_43250
UniProt: C1BA69
Position
4669591..4670448
Genome map
AA seq 285 aa AA seqDB search
MTVIELPSPGRTVVMGILNVTTDSFSDGGRFLDRDAALERGLALNRLGVDIVDVGGESTR
PGAARVDPDVEAGRVAPVIADLVAEGICVSVDTMRASVAEAAIEAGASIINDVAGGRADA
AMASVVADAGVPWILMHWRSAGDYVHRGAADHYDDVVREVRDELMTQVDLAVKAGVDPGS
LVLDPGLGFAKNSDHNWALLKALPEFNELGFPVLVGASRKRFLGSLLADADGEPRPPAGR
ETATAVVSALAATHGAWGVRVHDAQASLDAIAVAEAWTRGAAGRE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgatcgagctgccctcaccgggtcgcaccgtggtgatggggattctgaacgtc
accaccgattccttctccgacggcggacgctttctcgaccgtgacgcggcgctcgaacgc
ggtctcgcgttgaaccgtctcggcgtcgacatcgtcgacgtcggcggcgagtccacccgg
ccgggcgcggcgcgggtcgatcccgacgtcgaggccgggcgggtcgcacccgtcatcgcg
gatctggtcgccgagggcatctgcgtcagcgtcgacacgatgcgggcgtccgtcgcggag
gccgcgatcgaggcgggggcgtcgatcatcaacgacgtggcgggcggccgggccgatgcg
gcgatggcttcggtggtcgcggacgccggagttccgtggatcctgatgcattggcgttcg
gcaggcgactacgtgcaccgcggcgccgccgaccactatgacgacgtggtccgtgaggtc
cgggacgaactgatgacgcaggtcgacctggccgtgaaggccggggtggatccgggttcg
ctggtgctggacccgggtctcggtttcgcgaagaactccgatcacaactgggcgttgctg
aaggcgctgcccgagttcaacgagctgggattccctgttctcgtcggcgcctcccgcaag
cggttcctgggttcgctgctcgcggatgccgacggcgaaccccgtccccccgccggccgg
gagaccgcgaccgcggtcgtgtcggcgctcgccgcgacccacggagcatggggagtgcgc
gtgcacgacgcgcaggcctccctcgacgccatcgcggtcgccgaggcctggacgaggggt
gcagccggacgtgagtga

DBGET integrated database retrieval system