KEGG   Rhodococcus opacus: ROP_43270Help
Entry
ROP_43270         CDS       T00882                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rop  Rhodococcus opacus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rop00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4670800..4671312
Genome map
AA seq 170 aa AA seqDB search
MSRAVLSIGSNVGDSLAHLQSVLDGLGDAVVAVSPVYSTAPWGGVEQQDFLNAVVVADDP
ALDGWGWLRRGQELEAAADRVRVERWGPRTLDVDVVTCDDVRSDDPELTLPHPRAHERAF
VLIPWLDVEPDAVLPVDGTTTRVDVLLPLLDDEERAGVHRTGLALDRRSR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcgcggtgttgtcgatcgggtcgaacgtcggtgacagcctcgcccatctgcag
tccgtcctcgacggtctgggtgacgcggtcgttgcggtgtccccggtgtattcgacggcg
ccgtggggcggcgtcgagcagcaggacttcctcaacgcggtcgtcgtcgccgacgatccc
gcgctcgacggctggggctggttgcggcgtgggcaggaactcgaggccgccgccgaccgg
gtgcgggtcgaacggtggggtccgcgcacgctcgacgtcgacgtcgtcacgtgcgacgac
gtccgcagcgacgacccggaactgacgttgccgcatccgcgagcacacgaacgtgccttc
gtgctgattccgtggctggacgtcgaacccgacgccgtgttgcccgtcgacggcacgacg
acccgcgtggacgtgttgctgccgttgctggacgacgaagagcgggccggtgtgcaccgg
acgggcctcgccctggaccggcggtcgcgatga

DBGET integrated database retrieval system