KEGG   Rhodococcus opacus: ROP_44390Help
Entry
ROP_44390         CDS       T00882                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rop  Rhodococcus opacus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rop01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rop00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rop00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4787960..4789270)
Genome map
AA seq 436 aa AA seqDB search
MSPATGAELARSLEPLGVAIPSAVPTHWYNLAADLPEPVPPHLHPGTREPLGPEDLAPLF
PASLIEQEVATDRYIEIPETVREIYGMWRPSPLVRAHRLERVLGTPARIYYKYEGVSPVG
SHKPNTAVAQAYYNALEGTTKLTTETGAGQWGASLSFAGALLGLDVEVWQVRASYDAKPY
RRLQMEAYGGICHPSPSDLTEAGRAILAEHPDTTGSLGMAISEAVEVAANDPRAHYSLGS
VLNHVMLHQTVIGQEAMAQLEDAGEPIAHTVFGCAGGGSNLAGLTFPFLGRNLREGATTR
LIACEPAACPSLTQGEYRYDFGDVAGLTPLLKMYTLGNDFVPPAIHAGGLRYHGMSPMVS
HAVALGLMEATAIEQDDALTAGLLFARAEGIIPAPESTHGVAAAIAHARTVTEPEVVVIG
LSGNGQLDLPAYSRYV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtccccggcaaccggagcagaattggctcgttcattggaacctctgggggttgcgatt
ccctcggccgttcccacgcattggtacaacctggcggccgatcttccggaacccgttccg
ccgcatctgcatcccgggacgcgggagccgctgggaccggaagacctggcgccgctgttt
ccggcgagcctgatcgagcaggaggtcgcgaccgaccgctacatcgagatccccgaaacg
gtgcgggagatctacggcatgtggcgtccgtcgccgctggtgcgcgcgcatcggctcgag
cgggtgctcggcaccccggcgcggatctactacaagtacgagggcgtgagcccggtcggc
tcgcacaagccgaatacggctgtcgcgcaggcctactacaacgccctcgagggcaccacc
aagctcaccaccgagaccggcgcgggccagtggggcgcgtcgctgtcgttcgccggtgcg
ctgctcggtctcgacgtcgaggtgtggcaggtccgcgcgtcctacgacgcgaagccctac
cgccggctccagatggaggcgtacggcggcatctgccatccgtccccgtccgacctcacc
gaggcgggccgcgcgattctcgccgagcaccccgacacgacgggttcgctggggatggcg
atcagcgaggccgtcgaagtggccgcgaacgacccccgcgcgcactactcgctgggcagc
gtcctcaaccacgtcatgctccaccagaccgtgatcggccaggaggcgatggcccagctc
gaggatgcaggcgaaccgatcgcgcacacggtattcggttgcgccggaggcggttccaat
ctcgccggcctgaccttcccgttccttggccgcaacctgcgcgagggcgccaccacccgc
ctcatcgcgtgtgaaccggcggcctgcccgtcgctcacgcagggcgagtaccgctacgac
ttcggcgacgtcgcgggcctcacgccactgttgaagatgtacacgctgggcaacgacttc
gtaccgcctgcgatccatgcaggcggtctgcggtaccacggcatgtcgccgatggtctcg
cacgccgtcgccctcggactgatggaggccaccgcgatcgagcaggacgacgctctcacc
gcgggattgctgttcgcccgcgccgaaggcatcatccccgcgccggagtccacgcacggc
gtggccgcggccatcgcgcacgcccgcacggtcaccgaaccggaggtcgtggtcatcgga
ctgtccggcaacggccagctggatctgcccgcgtacagccggtacgtctga

DBGET integrated database retrieval system