KEGG   Rhodococcus opacus B4: ROP_44390Help
Entry
ROP_44390         CDS       T00882                                 

Definition
(GenBank) putative tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rop  Rhodococcus opacus B4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ROP_44390
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ROP_44390
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ROP_44390
Enzymes [BR:rop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ROP_44390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(4787960..4789270)
Genome map
AA seq 436 aa AA seqDB search
MSPATGAELARSLEPLGVAIPSAVPTHWYNLAADLPEPVPPHLHPGTREPLGPEDLAPLF
PASLIEQEVATDRYIEIPETVREIYGMWRPSPLVRAHRLERVLGTPARIYYKYEGVSPVG
SHKPNTAVAQAYYNALEGTTKLTTETGAGQWGASLSFAGALLGLDVEVWQVRASYDAKPY
RRLQMEAYGGICHPSPSDLTEAGRAILAEHPDTTGSLGMAISEAVEVAANDPRAHYSLGS
VLNHVMLHQTVIGQEAMAQLEDAGEPIAHTVFGCAGGGSNLAGLTFPFLGRNLREGATTR
LIACEPAACPSLTQGEYRYDFGDVAGLTPLLKMYTLGNDFVPPAIHAGGLRYHGMSPMVS
HAVALGLMEATAIEQDDALTAGLLFARAEGIIPAPESTHGVAAAIAHARTVTEPEVVVIG
LSGNGQLDLPAYSRYV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtccccggcaaccggagcagaattggctcgttcattggaacctctgggggttgcgatt
ccctcggccgttcccacgcattggtacaacctggcggccgatcttccggaacccgttccg
ccgcatctgcatcccgggacgcgggagccgctgggaccggaagacctggcgccgctgttt
ccggcgagcctgatcgagcaggaggtcgcgaccgaccgctacatcgagatccccgaaacg
gtgcgggagatctacggcatgtggcgtccgtcgccgctggtgcgcgcgcatcggctcgag
cgggtgctcggcaccccggcgcggatctactacaagtacgagggcgtgagcccggtcggc
tcgcacaagccgaatacggctgtcgcgcaggcctactacaacgccctcgagggcaccacc
aagctcaccaccgagaccggcgcgggccagtggggcgcgtcgctgtcgttcgccggtgcg
ctgctcggtctcgacgtcgaggtgtggcaggtccgcgcgtcctacgacgcgaagccctac
cgccggctccagatggaggcgtacggcggcatctgccatccgtccccgtccgacctcacc
gaggcgggccgcgcgattctcgccgagcaccccgacacgacgggttcgctggggatggcg
atcagcgaggccgtcgaagtggccgcgaacgacccccgcgcgcactactcgctgggcagc
gtcctcaaccacgtcatgctccaccagaccgtgatcggccaggaggcgatggcccagctc
gaggatgcaggcgaaccgatcgcgcacacggtattcggttgcgccggaggcggttccaat
ctcgccggcctgaccttcccgttccttggccgcaacctgcgcgagggcgccaccacccgc
ctcatcgcgtgtgaaccggcggcctgcccgtcgctcacgcagggcgagtaccgctacgac
ttcggcgacgtcgcgggcctcacgccactgttgaagatgtacacgctgggcaacgacttc
gtaccgcctgcgatccatgcaggcggtctgcggtaccacggcatgtcgccgatggtctcg
cacgccgtcgccctcggactgatggaggccaccgcgatcgagcaggacgacgctctcacc
gcgggattgctgttcgcccgcgccgaaggcatcatccccgcgccggagtccacgcacggc
gtggccgcggccatcgcgcacgcccgcacggtcaccgaaccggaggtcgtggtcatcgga
ctgtccggcaacggccagctggatctgcccgcgtacagccggtacgtctga

DBGET integrated database retrieval system