KEGG   Rhodococcus opacus B4: ROP_44490Help
Entry
ROP_44490         CDS       T00882                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rop  Rhodococcus opacus B4
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ROP_44490
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ROP_44490
   00650 Butanoate metabolism
    ROP_44490
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ROP_44490
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ROP_44490
   00622 Xylene degradation
    ROP_44490
   00621 Dioxin degradation
    ROP_44490
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ROP_44490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4797535..4798437
Genome map
AA seq 300 aa AA seqDB search
MTKASVAIVGSGNISTDLLYKLQRSEWLEPRWMIGIDPESEGLARARTMGLETSAEGVGW
LLNQPEKPDLVFEATSAHVHRDSAPRYEAAGIRAVDLTPAAVGPAVVPPANLREHLGAPN
VNMITCGGQATIPIVYAVSRVVDVPYAEIVASVASVSAGPGTRANIDEFTKTTSRGIETI
GGAQRGKAIIILNPADPPMIMRDTIFCAIPEDADRAAITDSIHRVVADIQQYVPGYRLLN
EPQFDDPSVVSGGQATVTTFVEVEGAGDFLPPYAGNLDIMTAAATKVGEEIAQKLLSVEA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcaagcgtggcgatcgtcggctcgggcaacatcagcaccgacctgctctac
aagctgcagcgatccgagtggctcgaaccccggtggatgatcgggatcgaccccgagagc
gaaggcctggcccgggcccgaacgatgggactggagacgtccgccgagggtgtcggctgg
ttgctgaaccagccggagaagcccgacctcgtcttcgaggcgacgtcggcgcacgtgcac
cgggattccgcaccgcggtacgaggccgcgggcatccgcgccgtcgacctcacccccgcc
gccgtcggaccggccgtggtcccgcccgccaacctgcgcgaacacctcggcgcccccaac
gtcaacatgatcacgtgcggcgggcaggcaacgatcccgatcgtgtacgcggtctcccgc
gtcgtcgacgtgccctacgccgagatcgtcgcatcggtcgcgtccgtctccgcgggcccg
ggcacccgcgccaacatcgacgagttcaccaagaccaccagccgcggcatcgaaaccatc
ggcggtgcgcagcgcggcaaggccatcatcatcctcaaccccgccgacccgccgatgatc
atgcgcgacacgatcttctgcgcgatccccgaggacgccgaccgcgccgccatcaccgat
tccatccaccgcgtggtcgccgacatccagcagtacgtccccggctaccgattgctcaac
gaaccgcagttcgacgacccgagcgtcgtgtcgggcgggcaggcgacggtcacgacgttc
gtcgaggtcgagggtgcgggcgacttcctgccgccgtacgcgggcaacctcgacatcatg
accgcggcggcaaccaaggtgggcgaggagatcgcccagaaactcctgagtgtggaggca
tga

DBGET integrated database retrieval system