KEGG   Rhodococcus opacus B4: ROP_46300Help
Entry
ROP_46300         CDS       T00882                                 

Definition
oxidoreductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rop  Rhodococcus opacus B4
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ROP_46300
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROP_46300
  Lipid metabolism
   00071 Fatty acid degradation
    ROP_46300
  Amino acid metabolism
   00350 Tyrosine metabolism
    ROP_46300
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ROP_46300
   00626 Naphthalene degradation
    ROP_46300
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ROP_46300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
4984054..4985013
Genome map
AA seq 319 aa AA seqDB search
MGIQRCRVADRACRCPRSHPGHGEVVVDLAAAGLCHTDVGITDGTMAEILGFTPIILGHE
AAGIVSAVGDGVDNVSVGKRVAVSAMGDGKSGVLGQKNIGVGRHGAYAEKTLAPASEIIA
LPDEVPFEQAAAATDAGMTSYHAVFVRGGLRPGTKVGIIGLGGLGMTAARLAVLGGGEVY
AAEINPRVHAAGIERGVKQVVGDVKELAEFELDLIVDFAGFGTTTAGAIEVVNNGGRVVQ
VGLGRSEATINTHLLTMKEVELRGSIGGTPADTVEVLKFISSGDLTISTKSIGFADIGSG
LEQLARSEVGGQRLVALFD
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgggtattcaacggtgtcgggtcgccgatcgagcttgtcgatgtccccgatcccacccg
ggtcacggcgaggtcgtcgtcgatcttgcggcggccggtctctgtcacacggacgtcggc
atcacagacgggacgatggctgagatcctcggcttcactcccatcatcctcggtcatgaa
gccgccggaatcgtctccgccgtcggcgacggggtcgacaacgtttcggtcggcaagcgt
gtcgcagtcagcgccatgggagacgggaagagcggagttctcggacagaagaacatcgga
gtcggccgccacggcgcgtacgccgaaaagactctggcgcctgcaagtgagatcatcgcc
cttccagacgaggttcccttcgaacaggcggccgcggcaaccgacgccgggatgacttca
taccacgcggtattcgttcgtggtggactgagacccggaacgaaggtggggatcatcggc
ctcggcggactcgggatgactgccgcgcggttggcagtgctcggcggcggtgaggtgtac
gcagctgagatcaatcctcgcgtccacgcggccggaatcgaacgcggcgtcaagcaggtt
gtcggcgatgtcaaggaacttgccgagttcgaactcgacctgattgtcgacttcgcagga
ttcggcacgacaactgccggtgcaatcgaggttgtcaacaatggtggacgcgtcgtccag
gtcggcctcggacggtcggaagcaaccatcaacacgcatcttctgaccatgaaagaggtg
gagttgcgggggtcgatcgggggaacgcccgccgacacggtcgaggtcttgaagttcatt
tcgtccggagatctgacgatctcgacgaagtcgatcggtttcgctgacatcggttccggc
ctggagcagttggcccgcagtgaagtcggtgggcagcggctcgtcgcactgttcgactga

DBGET integrated database retrieval system