KEGG   Rhodococcus opacus B4: ROP_46470Help
Entry
ROP_46470         CDS       T00882                                 

Gene name
limA
Definition
limonene-1,2-epoxide hydrolase (EC:3.3.2.8)
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
rop  Rhodococcus opacus B4
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ROP_46470 (limA)
Enzymes [BR:rop01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     ROP_46470 (limA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(4999630..5000079)
Genome map
AA seq 149 aa AA seqDB search
MTQSIQRPQWADPSSGAAKPVGADEALVLEFMEALSSNDADRLIDYFADDTMYQNMPLPA
AYGRDDVHTTLAGLFTVLRIDKIDTFYIASRDGIVFTERVDLLTALPTGKSFELPVNGIL
HIQDGKITEWRDYFDLRNFEEAVDFALGG
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtgacacagtcgattcaacgaccccagtgggccgacccgtcgtcgggagcagcgaaacct
gtgggcgccgacgaggcattggtgctcgagttcatggaggccctcagcagcaatgacgcc
gaccgtctcatcgactacttcgccgacgacacgatgtaccagaacatgcccctgcccgcc
gcgtatggacgcgatgacgtccatacgacgctcgccggcctgttcacggtgttgcgcatc
gacaagatcgacaccttctacatcgcgtcccgggatgggatcgtgttcaccgagagggtc
gatctgctgacggcgcttcccaccgggaagtcgttcgagttgcccgtcaacggcatcctg
cacatccaagacggcaagatcaccgaatggcgtgactacttcgacctgcgaaatttcgag
gaagccgtcgacttcgccctgggtggatag

DBGET integrated database retrieval system