KEGG   Rhodococcus opacus B4: ROP_47240Help
Entry
ROP_47240         CDS       T00882                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
rop  Rhodococcus opacus B4
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    ROP_47240
  Amino acid metabolism
   00380 Tryptophan metabolism
    ROP_47240
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ROP_47240
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     ROP_47240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5078926..5080323)
Genome map
AA seq 465 aa AA seqDB search
MSVESLHTTADAIIPHPRWRLPVFGDVFGISIRTPVQNSMEIGRQLGPIFERNILGNKFV
FASGADMVAELSDETRFAKHLAPGVASLREVGGDGLFTAYNHEPNWSKAHNLLAPAFTKS
AMRSYHRTMLDVAGELTQHWDQRVDGTPVDVSSDMTKLTLETIGRTGFSYSFDSFTRERP
HPFVQAMVGALSHSQRTTFVKSTALGRLLARRSDRRNVANLEHMAEVVDEVIRARRDSAE
AGPEDLLELMLRAARENDPNRIDELNIRHQVVTFLVAGHETTSGALSFALYYLSRHPDVL
AKAQAEVDAVWGDDEPAFEQIAKLRYVRRVLDESLRLWPTAPAYGREATVDTTLVGKYPM
KVGDWVLVLIPALHRDPVWGENPEEFDPDHFLPERNRSRPAHVYKPFGTGERACIGRQFA
LHEAVLVLGTILRRYDIVGDPGYRLKVAERLTLMPEGFTLRIRRR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgaatcactgcacaccacggcggacgcgatcatcccgcatcctcgatggcgg
cttcccgtcttcggggacgtgttcgggatcagcatccgcactcccgtgcagaattcgatg
gagatcggcaggcaactcgggccgatcttcgagcgcaacatcctcggcaacaagttcgtg
ttcgcgtccggtgccgacatggtggccgaactctccgacgaaacccgattcgcgaagcac
ctggcgccgggcgtcgcgtcgcttcgcgaggtgggcggcgacgggttgttcaccgcctac
aaccacgagccgaactggagcaaagcgcacaacctcctcgccccggcgttcacgaaatcc
gccatgcggtcgtatcaccggacgatgctggacgtcgccggcgaactcacgcagcactgg
gaccagcgggtggacggcacccccgtcgacgtgtcctccgacatgacgaagctgacgctc
gagaccatcggccgcaccgggttcagctactccttcgactcgttcacccgggagcgtccg
cacccgttcgtgcaggcgatggtcggggcgctgagccattcgcagcgcacgacgttcgtg
aagtccacggcgctcggacggttgctggcgcggcggtcggatcgtcgcaatgtcgccaac
ctggagcacatggccgaggtggtcgacgaggtgatccgcgcccgccgtgacagcgccgag
gccggccccgaggacctgctcgaactcatgctgcgggcggcgcgggagaacgatcccaac
cggatcgacgagttgaacatccgccaccaggtggtgacgttcctggttgccgggcacgag
accacctcgggcgcactgtcgttcgccctctactacctgtcgcggcaccccgacgtcctg
gccaaggcgcaggcggaggtcgatgcggtctggggcgacgacgagccggcgttcgagcag
atcgccaagctccgctacgtgcggcgggtgctcgacgaatcgttgcggctgtggccgacg
gcgcccgcctacggccgggaggccaccgtcgacacgaccctcgtgggcaagtacccgatg
aaggtcggcgactgggtcctcgtcctcatccccgccctgcaccgcgaccccgtgtggggt
gaaaatcccgaggaattcgaccccgaccacttccttcccgagcgcaaccggtcccggccc
gcgcacgtctacaaaccgttcgggaccggcgaacgcgcctgcatcggaaggcagttcgcc
ctccacgaggcggtgctcgttctcggcacgatcctgcgccggtacgacatcgtgggagac
cccggctaccggctgaaggtcgccgaacggctcactctcatgcccgagggattcaccctg
cggatccgccggcgctga

DBGET integrated database retrieval system