KEGG   Rhodococcus opacus B4: ROP_48490Help
Entry
ROP_48490         CDS       T00882                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rop  Rhodococcus opacus B4
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ROP_48490 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROP_48490 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    ROP_48490 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ROP_48490 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ROP_48490 (adh)
   00626 Naphthalene degradation
    ROP_48490 (adh)
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ROP_48490 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
5224507..5225553
Genome map
AA seq 348 aa AA seqDB search
MTIDTMRAVRMTVWGEPAQVLRVRVPEPQRAELLIEVRAAGLCRSDLHVMDAPAGVFDYP
LPLTLGHEVAGIVVGAGPDADSSWIGESVVVHGVWSCGECRNCRRGRENYCHALRPGADG
LLPAIGSGLGYDGGLADAMIVPSERFVVRTRGLAPESAAPLADAALTAYHAIRTNRELVD
SHSVAVVVGVGGLGHLAVQILRALGAGTVFAVDPRADSRALALRLGADAAFADLARIGES
TVADVVFDFVGSPATMDPAAQLLGPGGRLVAVGSGGGRLTVGKNLGLPNGWQVSAPFWGT
RTDLEAVVDLAHRGQLSVESAAYRLDDALDVYDRLRRGAITGRAVLVP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgacacgatgcgcgccgtgcgcatgaccgtctggggtgaacccgcgcaggtc
ctgcgcgtgcgcgttcccgaaccacagcgcgccgaactgctgatcgaggtccgggcggcc
gggctctgccgatccgacctgcatgtgatggacgcacccgcgggcgtcttcgactacccg
ctgccgctcacgctggggcacgaggtggccggaatcgtcgtcggcgcgggccccgacgcc
gacagttcgtggatcggcgagtccgtggtggtccacggcgtctggtcctgcggggagtgc
cgcaactgcaggcggggcagggagaactactgccacgccctgcggccgggggcggacggt
ctgctcccggccatcggcagcggtctcggctacgacggcggtctggccgacgccatgatc
gtcccctcggagcggttcgtggtgcgcacccgggggcttgcccccgagagtgccgccccg
ctcgccgacgctgccctgacggcgtaccacgcgatccgcacgaaccgggaactcgtcgac
agtcactccgtcgccgtggtggtgggggtcgggggactgggccatctcgccgtccagatc
ctgcgcgctctcggggcaggcaccgtgttcgccgtcgatccgcgtgcggattcccgcgcg
cttgcgctgcggctgggagccgacgcggcattcgccgacctcgcccggatcggtgagtcg
accgtcgccgatgtggtcttcgacttcgtcggctcgccggccacgatggacccggctgcg
cagttgctcggtcccggcggccgtctggtcgcggtgggcagcggcggaggccggctcacg
gtcggcaagaacctcggactacccaacggctggcaggtcagcgccccgttctggggaacg
cgcacggatctcgaggcggtggtcgacctcgcgcatcgagggcagttgagcgtcgagtcg
gccgcataccgattggacgacgccctcgacgtctacgaccgcctgcgccgcggagcgatc
accgggcgcgccgtcctcgtgccgtga

DBGET integrated database retrieval system