KEGG   Rhodococcus opacus B4: ROP_48680Help
Entry
ROP_48680         CDS       T00882                                 

Gene name
bdhA
Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00072  Synthesis and degradation of ketone bodies
rop00650  Butanoate metabolism
rop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ROP_48680 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    ROP_48680 (bdhA)
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     ROP_48680 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase AdoHcyase_NAD KR NAD_binding_10 TrkA_N
Motif
Other DBs
NCBI-ProteinID: BAH53115
NITE: ROP_48680
UniProt: C1BBR2
Position
complement(5247284..5248036)
Genome map
AA seq 250 aa AA seqDB search
MTEQNLAGRTALVTGGASGIGAACARALAARGAHVTVADLDDVAAKSLADEIDGTAWHVD
LLDTDPLTELRLETDILVNNAGIQTISPIEEFRPEDFRRIQTLMVEAPFLLIRAALPHMY
ATGFGRIVNVSSVHGLRASAFKAAYVTAKHGLEGLSKVTALEGGPHGVTSNCVNPGYVLT
PLVQKQIADQAQVHGISESDVIEKVMLTESAIKRLVEPAEVASLVAWLASADAGMVTGAS
YSIDGGWTAR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcagaacctggccgggcgcaccgcgctcgtcaccggcggcgccagcgggatc
ggcgcggcgtgcgcccgggcgctggcggcgcgcggagcccacgtcacggtcgccgacctc
gacgacgtggccgccaagagcctcgccgacgagatcgacggaacggcgtggcacgtcgac
ctcctcgacaccgatccgctcaccgagttgcggctcgagacggacatcctcgtcaacaac
gccgggatccaaaccatcagtcccatcgaggaattccgccccgaggacttccggcgcatc
cagacgctcatggtcgaggcgccgttcctgctgatccgtgccgccctgccgcacatgtac
gcgacgggtttcgggcgcatcgtcaacgtgtcgtcggtgcacgggctccgcgcctcggcg
ttcaaggccgcgtacgtcaccgccaagcacgggctcgagggactgtcgaaggtgacggca
ctcgagggcggtccgcacggggtcaccagcaactgcgtcaaccctggctacgtgctgacc
ccgttggtgcagaagcagatcgcggatcaggcgcaggtgcacggcatcagcgagtccgac
gtgatcgagaaggtgatgctcaccgagagcgcgatcaaacgactggtggaaccggcggag
gtcgcgtccctcgtcgcgtggctcgcgtccgccgacgcaggcatggtcaccggcgcctcc
tactcgatcgacggaggctggacggcccggtga

DBGET integrated database retrieval system