KEGG   Rhodococcus opacus B4: ROP_49080Help
Entry
ROP_49080         CDS       T00882                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rop  Rhodococcus opacus B4
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ROP_49080
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ROP_49080
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ROP_49080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
5303638..5304132
Genome map
AA seq 164 aa AA seqDB search
MTTPVQNIGINTLGGTPTSLGEYDGRAVLVVNVASKCGLTPQYKGLEKLATDYADRGLTV
LGVPCNQFMGQEPGTAEEIETFCSTTYGVTFPLLEKIEVNGENRHPLYEELAKTTDAEGA
AGDIQWNFEKFLVAPDGTVVKRFRPRTEPDAPEVVEAIEAILPK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcctgttcagaacatcggtatcaacacactcggcggcacgccgacctccctc
ggcgagtacgacggccgggccgtcctcgtggtgaacgtcgcctcgaagtgtggactcacc
ccgcagtacaagggcctcgagaagctcgccaccgactacgccgaccgcggcctgaccgtc
ctcggtgtcccgtgcaaccagttcatgggccaggaacccggcaccgccgaagagatcgaa
accttctgctccaccacctacggcgtcacgttcccgttgctcgagaagatcgaggtgaac
ggggagaaccggcacccgctctacgaggaactggccaagaccaccgacgccgaaggcgcc
gcgggcgacatccagtggaacttcgagaagttcctcgtcgcacccgacggcaccgtcgtc
aagcggttccggccccgcaccgaacccgacgcccccgaggtcgtcgaggccatcgaggcg
atcctgccgaagtag

DBGET integrated database retrieval system