KEGG   Rhodococcus opacus B4: ROP_49140Help
Entry
ROP_49140         CDS       T00882                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rop  Rhodococcus opacus B4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ROP_49140 (malQ)
Enzymes [BR:rop01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ROP_49140 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
5307536..5309641
Genome map
AA seq 701 aa AA seqDB search
MTYTEQLRDLAARHGVATSYRGWDQRRHDVRDDTLRSVLAALDVPAATDDEVRRALFECD
VAPWRSMLPPVVVGTDGSEARFVVHVPHGADVDVTIDTESGGTVRARQLQVWVDPREVDG
KLIGRATFAVPPGVPCGWHTVRASTSATSSSCTLVVTPARLSTSDHLRDRRRWGVLTQLY
SIRSRRSWGVGDFGDLADLASIFGSVHGADYVLVNPLHAAQPRPPIEASPYLPTTRRYVN
PLYVRVEDIPETAYLPTRRHARMRDAAARFERANDRPDRIARNPSYRAKLRVLERVFRIE
RSPSRQHAFEEFCRVEGDGLRDFATWCALTEKLPPDDPRWTTKAGAPDSDWVQAQRRKLA
PRIEFYSWLQWVCDEQLSDAQAAARAAGMDIGIVHDLAVGVQRGGADAWSLGTALAEGIT
VGAPPDDFNQQGQQWNQPPWRPDRLAELGYAPYRDMLRTVLKHAGGLRVDHILGLFRLWW
IPADAETPADGTYVTYDHEALIGILALEAERAGAVVIGEDLGVFEPAVQDYLAERGILGT
SILWFEHDGERPTPPEEYRTLCLTSVTTHDLPPTAGYLAGEHIELRSRLGLLERDLELEK
EHDAHQREAVLQLARDRGLLADDASIPDTVKALYRLIARSPSLLSGVALADLVGEHRVQN
QPGTDETQYSNWKIPLADASGRAVHVEDLADGDFGFLDDAR
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtacaccgagcagttgcgtgatctcgcggcccggcacggggtggcgacgtcgtac
cggggctgggatcagcggcggcacgacgtccgcgacgacaccctgcgcagcgtcctcgca
gcgctcgacgttcccgctgcaacggacgacgaggtgcggcgcgccctgttcgagtgcgac
gtggcgccgtggcggtcgatgctgccgcccgtcgtcgtcggaacggacggatccgaggcc
cgtttcgtggtccacgtcccacacggcgcggacgtggacgtcaccatcgacacggagtcg
ggcgggaccgtccgggcccgccaactccaggtgtgggtcgatccacgcgaggtcgacgga
aagctgatcggccgtgccacgttcgccgttccgcccggggtcccgtgcggatggcacacg
gtgcgggcgtcgacctcggccacctcctcgtcgtgcaccctcgtggtgacaccggcgcgg
ttgtccacgtccgaccatctgcgcgaccgccggcgctggggtgtgctcacgcagctgtac
tcgatccggtcgcgccggtcctggggtgtgggggatttcggcgatctcgccgatctcgcg
tcgatcttcggttccgtccacggcgccgactacgttctcgtcaatccgttgcatgcggcg
cagccccggccgccgatcgaggcgtcgccgtacctgccgaccacccggcgctacgtcaac
ccgctgtacgtccgcgtcgaggacatcccggagacggcgtacctcccgacccgacgtcat
gcgaggatgcgcgacgccgcagcgcgattcgagcgggcgaacgaccggcccgaccggatc
gcccgcaacccgtcgtaccgcgccaaactccgggtactcgaacgggtcttccggatcgag
cgcagcccgagcaggcagcacgcgttcgaggaattctgccgcgtcgagggcgacggactg
cgggacttcgcgacctggtgcgcgctcaccgagaaactaccgcccgacgacccgcgatgg
acgacgaaggccggtgcgcccgacagcgactgggtgcaggcgcagcggcgtaagctcgcg
ccgcgcatcgagttctactcgtggctgcaatgggtatgcgacgagcagctttccgacgcc
caggctgcggcacgcgcggcgggcatggacatcgggatcgtgcacgatctggccgtcggc
gtccagcgcgggggtgcggacgcgtggtcgctgggaacggctctggcagagggtattacc
gtcggcgctcctcccgacgacttcaatcagcagggtcagcaatggaatcagccgccgtgg
cggccggatcggctggccgaactgggatacgccccgtaccgcgacatgctgcgcaccgtg
ctgaagcatgcgggtgggctgcgggtcgatcacatcctggggctgttccggctgtggtgg
atccccgccgacgcggagacgccggcagacggaacgtacgtcacgtacgaccacgaggcg
ctgatcgggatcctcgcgctcgaggcggagcgcgcgggcgccgtggtgatcggcgaggac
ctcggggtgttcgaacccgcggtgcaggactacctcgccgagcgcggcatcctcgggacc
tcgatcctgtggttcgagcacgacggcgagcggccgacgccgcccgaggagtaccggacg
ctgtgcctgacatcggtgaccacgcacgatcttccgccgaccgccggatacctcgccggc
gagcacatcgaattgcggtcgcggctcgggctcctcgaacgcgacctcgaactcgagaag
gaacacgacgcgcaccagcgcgaggccgtactgcaactggcgcgcgaccgcggattgctg
gcggacgacgcgtcgatccccgacaccgtcaaggcgctgtaccggctgatcgcccggagt
ccctcgctgctgtcgggtgtcgcactcgccgatctggtgggggagcaccgcgtccagaat
cagccgggcaccgacgagacccagtattcgaactggaagattcccctcgcggacgcgtcc
gggcgtgccgtccacgtcgaggacctggcggacggcgatttcgggttcctcgacgacgcc
cgctga

DBGET integrated database retrieval system