KEGG   Rhodococcus opacus B4: ROP_50720Help
Entry
ROP_50720         CDS       T00882                                 

Gene name
asnB
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rop  Rhodococcus opacus B4
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ROP_50720 (asnB)
Enzymes [BR:rop01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ROP_50720 (asnB)
Peptidases [BR:rop01002]
 Cysteine Peptidases
  Family C44
   ROP_50720 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
5479271..5481112
Genome map
AA seq 613 aa AA seqDB search
MCGIAGWISFDRDLRVEQSTVDAMAETMNCRGPDDRGTWVVEHAALGHRRLAIIDLPGGH
QPMSVDSPGGTVAMVYSGEVYNFGELREELYGRGHRFATNSDTEVVLHGYLEWGEAVAER
LNGMYAFAIWDSRTDTLVMIRDRMGIKPFYYYETPDGVLFGSEPKAILANPIAEPTVTMD
GIRELFAFVKTPGHAVWEGMREVEPGTVVTVSRTGLRTHRYWTLQTRPHTDDRDTSVAHV
RELLDDIVRRQLVADVPRCTLLSGGLDSSAMTGIAAGQLAHAGETVRTFAVDFVGQTEHF
VADELRGTPDTPYVHDVARRSGTAHQDIVLDSDDLADPAVRAKVIRARDIPMGLGDMDAS
LYLLFKAIRQHSTVALSGESADEVFGGYKQFFDPKAQQANTFPWLVQFAEHFGDESNIFT
PDVTAGLRMDDYVQDSYDAAISGIDRLDGESDFEWRMRKICYLHLTRFVRVLLDRKDRAS
MAVGLEVRVPFCDHRLVEYVFNTPWSLKTFDGKEKSLLRAATSDVLPQSVIDRVKSPYPS
TQDPKYAVALQQHGKELLSDPAHPVFGLVSADWLSRAVSVDTPQISQVSRRGLERTLDLA
LWMDMYNPTIKLC
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgccggatggatctcgttcgaccgcgatctacgcgtcgaacagtccacc
gtggatgccatggcggagacgatgaactgccgggggccggacgatcgcggtacgtgggtc
gtcgaacatgcagctctcgggcaccgaaggctcgcgatcatcgatctgcccggcgggcat
cagccgatgagcgtggacagtcccggcgggaccgtggcgatggtctactcgggggaggtg
tacaacttcggtgaattgcgcgaggaactgtacgggcgcgggcaccggtttgccacgaac
tccgacaccgaggtggtgctccacgggtacctggaatggggcgaggccgtcgccgagcga
ctcaacggcatgtacgcgttcgccatctgggattcgcgcaccgacaccctggtgatgatc
cgtgaccgcatgggcatcaagccgttctactactacgagactcccgacggtgtgctgttc
ggttcggaacccaaagcgattcttgccaatccgatcgccgagccgaccgtcacgatggac
gggatccgggagctgttcgcgttcgtgaagacgccgggccacgccgtgtgggagggcatg
cgtgaggtggaaccgggcacggtggtcaccgtctcgcgcaccggactccggacgcaccgg
tactggacgctgcagacccgcccgcacaccgacgaccgggacacgtccgtcgcgcacgtc
cgcgaactcctcgacgacatcgtgcgcaggcaactggtcgccgacgtgccgcgctgcacc
ctgctgtccggtggtctcgactcctcggcgatgacgggcatcgccgccgggcagctcgcc
cacgcgggggagacggtccgcaccttcgccgtcgacttcgtcgggcagaccgaacatttc
gtcgccgacgaactgcggggcaccccggacaccccgtacgtgcacgacgtggcccgcagg
tccgggaccgcgcatcaggacatcgtcctcgactccgacgacctcgccgatcccgccgtg
cgtgcgaaggtcatccgcgctcgtgacatccccatgggtctcggcgacatggacgcgtcg
ctgtacctgctgttcaaggcgatccggcagcactccaccgtggcactgtccggtgagtcg
gcggacgaggtgttcggcggctacaagcagttcttcgacccgaaggctcagcaggcgaac
accttcccgtggctcgtgcagttcgccgagcacttcggcgacgagagcaacatcttcacc
ccggacgtcacggcggggctgcgcatggacgactacgtgcaggattcgtacgacgcagcg
atctccggaatcgaccggctggacggtgaatccgacttcgagtggcggatgcgcaagatc
tgctacctgcatctgacgcggttcgtccgggtccttctcgaccgtaaggaccgcgcgagc
atggccgtcgggctcgaggtgcgggtgccgttctgcgatcaccggttggtcgagtacgtg
ttcaacacgccgtggtcgctgaagacgttcgacggcaaggagaagtcgctgctgcgggcc
gcgaccagcgatgtgctgccccagtcggtgatcgaccgggtgaagtcgccgtacccgtcc
acgcaggaccccaagtacgcggtggcgttgcagcagcacggcaaggagttgctgagcgac
cccgcgcacccggtgttcggcctggtcagcgcggactggctgtcgcgagcggtgtccgtc
gacaccccgcagatcagtcaggtgtcgcgtcgcggactcgagcgcaccctcgacctcgcg
ttatggatggacatgtacaacccgacgatcaaactctgctaa

DBGET integrated database retrieval system