KEGG   Rhodococcus opacus B4: ROP_52350Help
Entry
ROP_52350         CDS       T00882                                 

Definition
sugar kinase (EC:2.7.1.-)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rop  Rhodococcus opacus B4
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROP_52350
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROP_52350
   00052 Galactose metabolism
    ROP_52350
   00500 Starch and sucrose metabolism
    ROP_52350
   00520 Amino sugar and nucleotide sugar metabolism
    ROP_52350
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ROP_52350
   00524 Butirosin and neomycin biosynthesis
    ROP_52350
Enzymes [BR:rop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ROP_52350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(5709630..5710517)
Genome map
AA seq 295 aa AA seqDB search
MVALALDIGGTKIAAGTVDADGTVPHPATTPTPATAVAAACAALLREVAGNAKVTSVGIA
CAGPVDTVAGTVSPINIEEWAGGFGLVGLVQEVFPGVRTRLAMDGAAAALGEYHHGAGRG
APDLLSLVVSTGIGGGVVLGGRIATGRTGNAGHIGHLVVPGGTEPCTCGGVGCLETVASG
PSSVRWARSRGWRGSTGVELARAAADGDAIAVASLDRAGTALGQAIASAAALLDVDLAVI
GGGFAQAGPPLWEPMHRAAARHARLSFVADLRVVPAELGASGTLVGAAVLAAGEG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgcgctggcactcgacatcggcggcaccaagatcgccgccgggaccgtcgacgcg
gacggcacggtgccgcacccggcgaccacgccgacgccggcgaccgcggtcgccgccgcg
tgcgccgccctgctgcgcgaggtcgcgggaaacgcgaaggtcacgtcggtcggcatcgcg
tgcgcgggaccggtcgacacggtcgccggcaccgtgtcgcccatcaacatcgaggagtgg
gcgggcgggttcggcctggtcggcctcgtgcaggaagtctttcccggcgtgcggacccga
ctcgccatggacggcgccgcggccgcgctcggcgaatatcaccacggcgccggtcgcggt
gcccccgacctgctgagtctcgtcgtgtccaccggcatcggcggcggggtggtcctcggc
ggccgcatcgccaccggccggaccggcaacgcgggccacatcgggcacctggtggtcccc
ggcggaaccgagccctgcacgtgcggcggagtcggatgcctggagacggtcgccagcgga
ccctcgtcggtgcgctgggcccggtcccggggatggcgcgggtcgaccggcgtcgaattg
gcgcgggccgccgcggacggcgacgcgatcgcggtggcgtccctcgaccgcgcggggacc
gcactggggcaggcgatcgcgtccgccgcggccctgctcgatgtcgatctcgcggtgatc
ggtgggggattcgcgcaggccgggccgccgttgtgggagccgatgcaccgggccgcggcc
cgccacgcccggctgtcgttcgtcgccgatctgcgagtggtgcccgcggaactgggcgcc
tccggaacgctcgtcggggcggccgtcctggccgccggcgagggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system