KEGG   Rhodococcus opacus B4: ROP_52460Help
Entry
ROP_52460         CDS       T00882                                 

Definition
glycosidase (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rop  Rhodococcus opacus B4
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ROP_52460
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    ROP_52460
Enzymes [BR:rop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ROP_52460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
5724529..5725704
Genome map
AA seq 391 aa AA seqDB search
MRIKYALALAACTGLVAGCSSGGGETVAESSPATPSPSSVEPASHTGTAAPAAAPVSCET
EFLQSLPLRRKLAQLLNVGVTGTADAAQVVRNEQVGGIFIGSWTDETMLANREVPQVASA
SSLPLMVTIDEEGGRVSRVENLLGADPSARQTAATMTEEQTYQMALERGRGLKDLGVTVN
FAPDVDVSSQPDDSVIGDRSYSDDPAVVTRYADAYARGMRDAGILPVIKHFPGHGSASGD
SHTGAVTTPPLDQLQTKDLVPFRNLVSTGVGVMLGHLEVPGLTAPGIPASISPDAVALLR
GGTGYGAPPFTGPIFTDDLSGMQAITDRYDITEAVETALESGVDVALWLTTDDVPRVLDH
LESVVASGKLPQQRVDEAVLTVARAKGALAC
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcaagtatgccctcgcgctcgcagcctgtaccggcctcgtggccgggtgttcg
tcgggtggtggcgagacggtcgcggagtcgtccccggcgacgccgtctccctcgtccgtc
gagcccgcgtcgcacaccggcaccgccgcgcccgccgccgcgccggtgtcctgcgagacg
gagttcctgcagtcgttgccgttgcggcgcaagctcgctcagctactgaacgtgggcgtc
accggcaccgcggatgccgcgcaggtggtccggaacgagcaggtcggcggcatcttcatc
ggaagctggaccgacgagacgatgctcgcgaaccgcgaggttccccaggtggcctcggcg
tcgtcgctgccgctgatggtgaccatcgacgaggaaggcgggcgggtctcacgcgtcgag
aacctgctcggcgccgacccgtccgcccggcagaccgccgccacgatgacggaggagcag
acgtatcagatggcgctcgagcgcgggcgcggactgaaggacctcggggtcaccgtcaac
ttcgcgcccgacgtcgacgtcagcagccagcccgacgacagcgtcatcggcgaccgctcc
tactccgacgatcccgccgtcgtcacccgctacgccgacgcctacgcgcgcggcatgcgg
gacgcgggaatcctgccggtgatcaagcacttccccggtcacggatccgcgtccggcgac
tcccacaccggcgccgtcaccaccccgccgctcgaccagttgcagaccaaggacctcgtc
ccgttccggaacctggtgtccaccggtgtcggcgtcatgctcggccacctcgaggtgccc
ggcctgacggcccccgggatcccagccagcatcagccccgacgcggtggcgctgctgcgc
ggcggcaccggctacggcgcaccgccgttcaccggccccatcttcaccgacgacctcagc
ggcatgcaggcgatcaccgaccgctacgacatcaccgaggccgtcgagacggcactcgag
tccggggtcgacgtcgcgctgtggctcaccaccgacgacgtcccgcgggtcctcgatcac
ctcgaaagcgttgtggcctcgggcaagctgccgcagcagcgggtcgacgaggcggtgctg
acggtcgcgcgtgccaagggtgccctcgcctgctag

DBGET integrated database retrieval system