KEGG   Rhodococcus opacus: ROP_55640Help
Entry
ROP_55640         CDS       T00882                                 

Gene name
bga
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
rop  Rhodococcus opacus
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rop00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(6086568..6088652)
Genome map
AA seq 694 aa AA seqDB search
MSMHTASDSGGRHLRWPTRGISFGGDYNPEQWPEEVWQRDVELMREAGVDFATVGVFSWA
RLQPTPSTWDFGWLDRVLDLLDGGGVRVDLATATASPPPWLTAAHPEIRPVDERGYRYEI
GSRQTWSPSSPIYREHSLVLVEKMATRYGDHPALALWHVSNELGCHNSRCHSPDSARAFR
RWLQRRYGDLTELNRAWGTTFWSQHYGDWDEVVPPSASTTFGNPTHLLDWRRFCSDALLD
QYLAEREVLRRITPDVPVTTNFMVGMGSPQSLAGDMNYAQWAPEQDLVSTDHYLVGPAAG
DGAAHHRLSFSADLTRGIADSRPWLLMEHSTSAVNWQPVNRAKAPGEMLRNSLAHVARGA
DGIAFFQFRASQAGAEKFHSALVPHAGPDSARWREVVQLGAVLRRLEPVAGSRVEAPVGV
LFDWESQWACEQDGHPSRLMQPMTIAEQMHRAFAGVTCDVVPPDADLDRYSVLVVPAMYL
CSDGDAARIEAAARAGAQVLVTAFSGIADRDDHVRLGGYPGAFRDLLGVRVEEFFPLGAD
ETAALDDGTSARTWTEYLTVSEDVDVLARHAEGHLQGVPAVTRRSVGDGAAWYLATVPDP
RGLERIAESICSAAGLALHTGQHSDVEIVRRRGEHGSWLFVLNHTNEKVTVDVSGTDLVT
ERVVDGPLTLEPGNCAVIREDGAGTGAPTRKADA
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatgcacacagcgagcgactccggcgggcggcacctgaggtggccgacccggggc
atttccttcggcggggactacaaccccgagcagtggccggaagaggtctggcagcgcgac
gtcgaactcatgcgcgaggcgggcgtcgacttcgcgaccgtcggcgtgttctcctgggcg
cggctgcagcccaccccctccacctgggacttcggctggctcgaccgcgtcctcgacctc
ctggacggcggtggcgtccgcgtcgacctggccaccgccaccgcgtccccgccaccgtgg
ctcacggccgcgcatcccgagatccggcccgtggacgagcgcggctaccggtacgagatc
ggcagcaggcagacgtggagccccagttcgccgatctaccgcgagcactccctcgtcctc
gtcgagaagatggccacccgctacggcgaccacccggcgctcgcgctctggcacgtgtcg
aacgaactcgggtgccacaactcgcgctgccactcccccgacagcgcgcgggcgttccgg
cggtggctgcagcggcgctacggcgacctcaccgaactcaaccgggcgtggggcacgacg
ttctggagccagcactacggcgactgggacgaggtggtgccaccgtccgcgagcacgacc
ttcggcaatcccacgcatcttctggactggcgccggttctgctcggacgccctgctcgat
cagtacctcgccgagcgggaagtgttgcggcgtatcacccccgacgtgccggtcacgacg
aatttcatggtgggcatgggctcgccgcagtcgctcgccggcgacatgaactatgcacag
tgggcgcccgagcaggatctggtgtcgaccgaccactacctggtggggcccgcggcgggc
gacggcgccgcccaccaccggctgtcgttctccgccgacctgacccgcggcatcgccgac
tcacggccgtggctgctgatggaacattcgacgagcgccgtcaactggcagccggtcaac
cgggcgaaggcacccggcgagatgctgcgcaactccctcgcccacgtcgcccgcggagcg
gacggcatcgccttcttccaattccgcgcctcgcaggccggcgccgagaagttccactcg
gccctggttccgcacgcgggccccgactccgcccggtggcgggaagtcgtccaactcggc
gccgtgctgcgccgcctcgaaccggtggccggcagtcgcgtcgaggcgccggtgggggtg
ctgttcgactgggagtcgcagtgggcgtgcgagcaggacggccacccgtcgcggctgatg
cagccgatgacgatcgccgagcagatgcaccgcgcattcgccggagtgacctgcgacgtc
gtccccccggacgccgacctcgaccgctactcggtgctggtggtgcccgcgatgtatctg
tgcagcgacggggacgccgcgcgcatcgaggcagccgcccgcgcaggcgcccaggtgctc
gtcaccgcattctccgggatcgcggaccgtgacgaccacgtccggctcggcggctacccg
ggtgcgttccgagacctgctcggcgtccgcgtcgaggagttcttcccgctcggcgccgac
gagaccgccgccctcgacgacggcacctcggcccgcacctggaccgagtacctcacggtg
tccgaggacgtggacgtcctcgcccgccacgccgagggacacctgcagggcgtgcccgcc
gtcacccggcgctccgtcggcgacggcgccgcctggtatctcgcgaccgtccccgacccg
cgcggactggagagaatcgccgaatcgatttgctccgcagccggtctcgcactgcacacc
gggcagcactccgacgtcgagatcgtccgcaggcggggcgagcacgggtcgtggctgttc
gtcctcaaccatacgaacgagaaggtgaccgtcgacgtgtccggcaccgacctcgtcacc
gaacgggtcgtcgacggacccctcacgctggaaccgggcaactgtgctgtgattcgcgaa
gacggcgccggcaccggcgccccgacccggaaggcggacgcatga

DBGET integrated database retrieval system