KEGG   Rhodococcus opacus B4: ROP_55640Help
Entry
ROP_55640         CDS       T00882                                 

Gene name
bga
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
rop  Rhodococcus opacus B4
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ROP_55640 (bga)
Enzymes [BR:rop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ROP_55640 (bga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(6086568..6088652)
Genome map
AA seq 694 aa AA seqDB search
MSMHTASDSGGRHLRWPTRGISFGGDYNPEQWPEEVWQRDVELMREAGVDFATVGVFSWA
RLQPTPSTWDFGWLDRVLDLLDGGGVRVDLATATASPPPWLTAAHPEIRPVDERGYRYEI
GSRQTWSPSSPIYREHSLVLVEKMATRYGDHPALALWHVSNELGCHNSRCHSPDSARAFR
RWLQRRYGDLTELNRAWGTTFWSQHYGDWDEVVPPSASTTFGNPTHLLDWRRFCSDALLD
QYLAEREVLRRITPDVPVTTNFMVGMGSPQSLAGDMNYAQWAPEQDLVSTDHYLVGPAAG
DGAAHHRLSFSADLTRGIADSRPWLLMEHSTSAVNWQPVNRAKAPGEMLRNSLAHVARGA
DGIAFFQFRASQAGAEKFHSALVPHAGPDSARWREVVQLGAVLRRLEPVAGSRVEAPVGV
LFDWESQWACEQDGHPSRLMQPMTIAEQMHRAFAGVTCDVVPPDADLDRYSVLVVPAMYL
CSDGDAARIEAAARAGAQVLVTAFSGIADRDDHVRLGGYPGAFRDLLGVRVEEFFPLGAD
ETAALDDGTSARTWTEYLTVSEDVDVLARHAEGHLQGVPAVTRRSVGDGAAWYLATVPDP
RGLERIAESICSAAGLALHTGQHSDVEIVRRRGEHGSWLFVLNHTNEKVTVDVSGTDLVT
ERVVDGPLTLEPGNCAVIREDGAGTGAPTRKADA
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatgcacacagcgagcgactccggcgggcggcacctgaggtggccgacccggggc
atttccttcggcggggactacaaccccgagcagtggccggaagaggtctggcagcgcgac
gtcgaactcatgcgcgaggcgggcgtcgacttcgcgaccgtcggcgtgttctcctgggcg
cggctgcagcccaccccctccacctgggacttcggctggctcgaccgcgtcctcgacctc
ctggacggcggtggcgtccgcgtcgacctggccaccgccaccgcgtccccgccaccgtgg
ctcacggccgcgcatcccgagatccggcccgtggacgagcgcggctaccggtacgagatc
ggcagcaggcagacgtggagccccagttcgccgatctaccgcgagcactccctcgtcctc
gtcgagaagatggccacccgctacggcgaccacccggcgctcgcgctctggcacgtgtcg
aacgaactcgggtgccacaactcgcgctgccactcccccgacagcgcgcgggcgttccgg
cggtggctgcagcggcgctacggcgacctcaccgaactcaaccgggcgtggggcacgacg
ttctggagccagcactacggcgactgggacgaggtggtgccaccgtccgcgagcacgacc
ttcggcaatcccacgcatcttctggactggcgccggttctgctcggacgccctgctcgat
cagtacctcgccgagcgggaagtgttgcggcgtatcacccccgacgtgccggtcacgacg
aatttcatggtgggcatgggctcgccgcagtcgctcgccggcgacatgaactatgcacag
tgggcgcccgagcaggatctggtgtcgaccgaccactacctggtggggcccgcggcgggc
gacggcgccgcccaccaccggctgtcgttctccgccgacctgacccgcggcatcgccgac
tcacggccgtggctgctgatggaacattcgacgagcgccgtcaactggcagccggtcaac
cgggcgaaggcacccggcgagatgctgcgcaactccctcgcccacgtcgcccgcggagcg
gacggcatcgccttcttccaattccgcgcctcgcaggccggcgccgagaagttccactcg
gccctggttccgcacgcgggccccgactccgcccggtggcgggaagtcgtccaactcggc
gccgtgctgcgccgcctcgaaccggtggccggcagtcgcgtcgaggcgccggtgggggtg
ctgttcgactgggagtcgcagtgggcgtgcgagcaggacggccacccgtcgcggctgatg
cagccgatgacgatcgccgagcagatgcaccgcgcattcgccggagtgacctgcgacgtc
gtccccccggacgccgacctcgaccgctactcggtgctggtggtgcccgcgatgtatctg
tgcagcgacggggacgccgcgcgcatcgaggcagccgcccgcgcaggcgcccaggtgctc
gtcaccgcattctccgggatcgcggaccgtgacgaccacgtccggctcggcggctacccg
ggtgcgttccgagacctgctcggcgtccgcgtcgaggagttcttcccgctcggcgccgac
gagaccgccgccctcgacgacggcacctcggcccgcacctggaccgagtacctcacggtg
tccgaggacgtggacgtcctcgcccgccacgccgagggacacctgcagggcgtgcccgcc
gtcacccggcgctccgtcggcgacggcgccgcctggtatctcgcgaccgtccccgacccg
cgcggactggagagaatcgccgaatcgatttgctccgcagccggtctcgcactgcacacc
gggcagcactccgacgtcgagatcgtccgcaggcggggcgagcacgggtcgtggctgttc
gtcctcaaccatacgaacgagaaggtgaccgtcgacgtgtccggcaccgacctcgtcacc
gaacgggtcgtcgacggacccctcacgctggaaccgggcaactgtgctgtgattcgcgaa
gacggcgccggcaccggcgccccgacccggaaggcggacgcatga

DBGET integrated database retrieval system