KEGG   Rhodococcus opacus B4: ROP_56420Help
Entry
ROP_56420         CDS       T00882                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00020  Citrate cycle (TCA cycle)
rop00640  Propanoate metabolism
rop00660  C5-Branched dibasic acid metabolism
rop01100  Metabolic pathways
rop01110  Biosynthesis of secondary metabolites
rop01120  Microbial metabolism in diverse environments
rop01130  Biosynthesis of antibiotics
rop01200  Carbon metabolism
Module
rop_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rop_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ROP_56420 (sucC)
   00640 Propanoate metabolism
    ROP_56420 (sucC)
   00660 C5-Branched dibasic acid metabolism
    ROP_56420 (sucC)
Enzymes [BR:rop01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ROP_56420 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: BAH53889
NITE: ROP_56420
UniProt: C1AWW6
Position
6167539..6168708
Genome map
AA seq 389 aa AA seqDB search
MDLFEYQAKELFAKHEVPTSAGRVTDTVAGAREIAEEIGKPVMVKAQVKVGGRGKAGGVK
YSADVDAAQANAEAILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRTNRTYLAMCSVE
GGVEIEVTAEENPDALAKIPVDAVKGVDLAFARSIAEAGKLPAEVLDAAAVTIQKLWEVF
IKEDALLVEVNPLVRTPNDEILALDGKVTLDENAAFRQPGHEAFEDKDATDPLELKAKEN
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMANGLD
VILNDAQVKSVFVNVFGGITACDAVANGIVGALKTLGDEANKPLVVRLDGNNVEEGRRIL
AEAAHPLVTVVGTMDEAADKAAELAFAAK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttcgaataccaggcgaaggaactcttcgccaagcacgaggtgccgacttcg
gctgggcgtgttaccgacacggtggccggcgcacgcgagattgccgaagaaatcggcaag
cccgtgatggtcaaggcgcaggtcaaggtcggcgggcgcggcaaggcgggtggcgtcaag
tactccgccgacgtcgacgcagcacaggccaacgccgaggcgatcctgggactcgacatc
aagggccacgtcgtcaagaagctgctggtcgcagaggcgagtgacatcgccgaggagtac
tacatctccttcctgctggaccgcaccaaccgcacctacctggccatgtgctcggtcgag
ggtggcgtcgagatcgaggtcaccgccgaggagaaccccgacgcactcgcgaagatcccc
gtggacgccgtcaagggcgtcgacctcgcgttcgcgcgcagcatcgccgaggcaggaaag
ctgcccgccgaggtgctcgacgcagcggccgtgacgatccagaagctgtgggaggtcttc
atcaaggaagacgctctcctcgtcgaggtcaaccccctcgtccgcacgccgaacgacgag
atcctcgcgctcgacggcaaggtcacgctggacgagaacgccgcgttccgtcagcccggc
cacgaggcgttcgaggacaaggacgccaccgacccgctcgagctcaaggccaaggaaaac
gacctcaactacgtcaagctcgacggtgaggtcggcatcatcggtaacggcgccggcctg
gtcatgtcgaccctggacgtcgtcgcgtacgcaggtgagaagcacggtggcgtgaagccc
gccaacttcctcgacatcggtggcggcgcctccgcagaggtcatggcgaacggcctggac
gtcatcctgaacgacgcgcaggtcaagagcgtgttcgtgaacgttttcggtggcatcacc
gcgtgtgacgcggtcgccaacggcatcgtcggcgccctgaagacgctgggtgacgaggcc
aacaagccgctggtcgtccgcctggacggcaacaacgtcgaagagggtcgtcgtatcctc
gccgaggccgcccacccgctggtcacggtcgtcggaaccatggacgaggctgccgacaag
gccgccgagctggccttcgccgcaaagtaa

DBGET integrated database retrieval system