KEGG   Rhodococcus opacus B4: ROP_56540Help
Entry
ROP_56540         CDS       T00882                                 

Definition
hypothetical protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rop  Rhodococcus opacus B4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ROP_56540
Enzymes [BR:rop01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ROP_56540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6179951..6181336
Genome map
AA seq 461 aa AA seqDB search
MTSSEHRPSTVGELRESGHVQRTVKEEIRENLLAALRDGRDPWPGIVGFEETVEPQLERA
LIAGHDVVLLGERGQGKTRLLRTLNLLLDEWTPVIAGSELGEHPYEPITPASIRRAQELG
DSLPVAWRHRSERYSEKLATPDTSVADLVGDVDPVKVAEGRSLGDPETIHFGLVPRAHRG
IVAINELPDLAERIQVSLLNVMEERDIQVRGYTLRLPLDVLMVASANPEDYTNRGRIITP
LKDRFGAEIRTHYPTRLDDEVAVILQEAHLTAEVPEYLLEILARFTRLLRESTSVDQRSG
VSARFAVAGAETVSAAAVHRGAVLGEADPVARPVDLETVVDVLRGKVEFESGEEGREIEV
LEHLLRRATADTVRTRLGGIDLAELVDAVEQGDPVVTGERITAKALLNELPELEVLDVLA
ERLGAESDGERAAAAEFALEGLYLARRISKNPDINGQTVYS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcatcggaacacagaccttccaccgtcggcgagctccgcgagtcgggccacgtt
caacgcaccgtcaaggaagagatccgcgagaacctgctcgcggcgctccgcgacggccgc
gatccgtggcccggcatcgtcggtttcgaagagacggtggaaccccagctcgaacgagca
ctcatcgcaggtcacgatgtggttttgctcggcgaacggggccagggcaagacccgcctc
ctccgcaccctcaatctgctcctcgacgaatggaccccggtgatcgccggttccgaactc
ggggagcatccctatgagcccatcaccccggcatcgatccgcagggcgcaggaattgggt
gacagcctgcccgtcgcgtggcggcaccgcagtgagcggtactcggagaagctcgcgacc
cccgacacgtcggtggcggacctggtcggcgacgtggatccggtcaaggtcgcggagggc
cgcagtctcggcgacccggagaccatccacttcggtctcgtcccccgcgcgcaccggggc
atcgtcgccatcaacgagctgcccgacctcgccgaacgcatccaggtgtcgctgctcaac
gtcatggaggaacgcgacatccaggtccgcgggtacaccctccggctaccgctggacgtc
ctcatggtggccagtgcgaacccggaggactacacgaaccgcggtcgcatcatcaccccg
ctgaaggaccggttcggcgcggagatccggacgcactacccgacgcgtctcgacgacgag
gtcgcggtcatcctccaggaggcgcacctcaccgcagaggtgcccgagtatcttctcgag
atcctggcccggttcacccggctgctccgcgagtcgacgtcggtcgatcagcggtcgggg
gtgtccgcccgcttcgcggtggccggcgccgaaaccgtcagtgcggctgcggtgcatcgc
ggcgcggtgctcggtgaggccgacccggtcgcgcggccggtcgacctcgagaccgtcgtc
gacgtgctgcggggcaaggtggaattcgaatccggtgaggagggacgcgagatcgaggtg
ctcgagcacctgctccggcgggcgacggccgacacggtccgcacccggctcggcggcatc
gacctcgccgaactcgtggatgccgtcgagcagggcgacccggtggtcaccggcgaacgg
atcacggcgaaggcactgctgaacgaactgcccgaactcgaggtcctcgacgtgctcgcc
gagcgtctgggcgcggagtccgacggcgagcgggccgcggcggccgagttcgcgctcgag
gggctgtacctggcgcggcggatctccaagaacccggacatcaacgggcagacggtgtat
tcgtaa

DBGET integrated database retrieval system