KEGG   Rhodococcus opacus B4: ROP_57450Help
Entry
ROP_57450         CDS       T00882                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rop  Rhodococcus opacus B4
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ROP_57450 (ispE)
Enzymes [BR:rop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ROP_57450 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6274462..6275397
Genome map
AA seq 311 aa AA seqDB search
MLSVVPRPVVVRAPSKVNLHLAVGDLRDDGYHELKTVFQALSLGDTVSVVPAETLSVKVR
GEDARVVPTDSRNLVWQAAEMLAAESGRRPDVEIAIDKGIPVAGGMAGGSADAAATLVGL
NALWQLDLSREELDGFAAKLGSDVPFSLHGGTAVGTGRGERLLPVLSRSTFHWVLALAKG
GLSTPTVFRELDRLRADGNPPRLGGPEDLMHALTTGDAATLAPLLGNDLQSAALSLNPGL
RRTLRAGVAAGALAGIVSGSGPTCAFLCADADAAVRVSAELAGAGVCRTVRVASGPVPGA
RIINDAAEGSH
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgctttccgtcgttcctcgccccgtcgtcgtcagggcgccgtccaaggtcaatctgcat
ctggccgtcggggacctgcgcgacgacggctatcacgagctgaagacggtgttccaggcg
ctctcgctcggcgacacggtgtcggtggtcccggcggagacgctgtcggtgaaggtccgc
ggtgaggacgcccgcgtcgtgcccaccgacagcagaaacctcgtgtggcaggcggcggag
atgctcgccgccgaatcggggcggcgaccggacgtcgagatcgcgatcgacaagggcatc
ccggtggccggcgggatggccggcggcagcgccgacgccgcagcgacgctggtcggtctg
aacgccctgtggcagctcgacctgtcgcgggaggaactcgacgggttcgccgcgaaactc
ggcagcgacgtgccgttctccctccacggcggcaccgcggtcgggacgggacgcggcgag
cgacttctgccggtgctctcccgcagcacgttccactgggtgctcgcgctcgcgaagggc
ggcttgagcacaccgacggtgttccgggagctggaccggctgcgtgccgacgggaatccg
ccgcgactcggcggccccgaggacctgatgcacgccctgacaacgggcgacgccgcgacg
ctggccccgttgctgggcaacgacctgcagtcggccgcgctgtcgctgaacccgggtctg
cggcggacgctacgcgccggggtcgcggcgggcgcgctggccggaatcgtctccggatcc
ggcccgacctgtgcctttctatgtgctgacgcggatgccgcggtccgagtcagtgcagaa
ctcgctggtgcgggggtgtgtcgcacggtgcgggttgccagcggacccgtacccggcgcc
cgaataatcaacgacgcggcggagggatcgcactga

  All links  
No link information was found.   
DBGET integrated database retrieval system