KEGG   Rhodococcus opacus B4: ROP_57660Help
Entry
ROP_57660         CDS       T00882                                 

Definition
hypothetical protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
rop  Rhodococcus opacus B4
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    ROP_57660
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     ROP_57660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(6297287..6298759)
Genome map
AA seq 490 aa AA seqDB search
MADATPIRPRSAAEVAEWDYEADVVVAGYGIAGVSAAIEAARAGADVLVLERTSGWGGAA
ALAGGFIYLGGGTPLQKACGFEDTPENMKTFMMAALGPGADEEKITDYCEGSVEHYNWLV
DCGVPFKESFWAEPGWEPPFDDGLMYSGGENAAPFNEIATPAPRGHVPQMDGKRTGEKGG
GYMLMKPLVETAEKLGVRAEYDMRVQTLITDDTGRVVGILAKQYGKEVAVRARRGVVLAT
GSFAYNDKMIEAHAPRLIGRPGAAIEEHDGRSILMAQALGADLAHMDATEVAFVCDPQLI
VRGILVNGRGQRYVPEDTYSGRIGQMTLFHQDNQAFLVIDEAAYEEGSAATTATPFLRVQ
PKWVAETVEELESDMGLPAGALQSTVEVYNKHAAEGSDPLLHKKSEWVKPIGTPVAALDL
RGFTLGFTLGGLRTSIDSEVLHVSGEPIPGLFAAGRCTSGVCAGGYASGTSLGDGSFYGR
RAGISAAKQP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgccacaccgatccgcccccggtccgcagcagaagtagccgagtgggactac
gaggccgacgtcgtggtcgccggctacggcatcgccggtgtgtccgccgccatcgaggcg
gcacgcgccggcgccgacgttctcgttctcgagcgcaccagtgggtggggcggcgccgct
gcgctcgcgggcggattcatctacctcggcggtggcacccccctgcagaaggcgtgcggg
ttcgaggacacccccgagaacatgaagacgttcatgatggcggcgctcggcccgggcgcc
gacgaggagaagatcaccgactactgcgagggcagcgtcgagcactacaactggctcgtc
gactgcggcgttccgttcaaggagagcttctgggccgaacccggctgggagcccccgttc
gacgacggtctcatgtactccggcggcgagaatgcggcacccttcaacgagatcgccacc
cccgcgccgcgcgggcacgttccgcagatggacggcaagcggaccggcgagaagggcggc
ggctacatgctcatgaagccgctcgtcgagaccgccgaaaagctcggagtccgagccgaa
tacgacatgcgggtccagacgctgatcaccgacgacacggggcgcgtggtcgggatcctc
gcgaagcagtacggcaaggaggtcgccgtccgggcacgccggggcgtcgtcctcgcgacc
ggcagcttcgcctacaacgacaagatgatcgaggcccacgcgccgcgcctcatcggaagg
cccggcgccgccatcgaggaacacgacggccggtcgatcctcatggcgcaggcgctcggc
gccgacctcgcgcacatggacgccacggaagtggccttcgtctgcgaccctcagctgatc
gtccgcggcatcctcgtcaacgggcggggacagcggtacgtccccgaggacacctactcc
ggccgcatcggccagatgacgctgttccaccaggacaaccaggcgttcctcgtcatcgac
gaggccgcgtacgaggaggggtcggcggcgaccaccgccacccccttcctgcgggtgcag
ccgaagtgggtggccgagaccgtcgaggaactcgagtccgacatgggcctgcccgcaggc
gcactccaatcgaccgtcgaggtgtacaacaagcacgcagccgaagggtcggacccgctg
ctgcacaagaagtccgagtgggtgaagccgatcggcacgcccgtcgccgccctcgacctg
cgcgggttcacgctgggcttcacgctcggcggactgcgcaccagcatcgattccgaagtg
ctgcacgtttccggcgaacccattcccggcctcttcgccgccggacggtgcacgtccggg
gtgtgcgccggcggctacgcgagcggcacgtccctcggcgacggcagcttctacggccgc
cgcgccggcatcagtgcagcgaagcagccctga

DBGET integrated database retrieval system