KEGG   Rhodococcus opacus B4: ROP_60010Help
Entry
ROP_60010         CDS       T00882                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rop  Rhodococcus opacus B4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ROP_60010
Enzymes [BR:rop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ROP_60010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
6562200..6563033
Genome map
AA seq 277 aa AA seqDB search
MSNDELSGLTIAVTAERRAAEFITLLERHGAAIVHTPAIHVLPLVDDSDLRARTADLIAS
PPDLLVVSTAVGFRGWLDAARAWDEEDALLTALQSARIITRGPKAKGAVRGAGLREEWSP
DTESSEEVHEHLVAQGVRGLRVAVQLHGTITEWEPMTDLSVSLAGAGADTTAVSVYRWIR
PENQQPLSTLLDRIIRAEVDAVTFTSAPAVSSLLSTAKDTDRVDALLHAFHGPVAPVCVG
AVTASPLTVLGVDTMQPARPRLGSLAKYIIEELPKRR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgacgaactttccggactgaccatcgccgtcaccgccgaacgccgggcagcc
gagttcatcacgctcctcgagcggcacggcgccgccatcgtccacaccccggccatccac
gtgcttccgctcgtcgacgactccgatctgcgcgcccgcaccgccgatctcatcgcgtcg
ccgccggacctcctcgtggtcagcaccgccgtcggattccgggggtggctggacgcggcg
cgggcctgggacgaggaggacgcgctgctcaccgccctgcagtcggcgcggatcatcacc
cgcgggcccaaggcgaagggcgccgtccgcggcgccggcctgcgcgaggagtggtcgccc
gacaccgaatcgtccgaggaagtgcacgaacatctcgtggcccagggcgtgcgcggacta
cgcgtcgcggtccagttgcacggcaccatcaccgagtgggagccgatgaccgacctgagc
gtctccctcgccggcgccggggcggacacgacggccgtgtcggtgtaccggtggatcaga
cccgagaaccagcagccactgtcgacgctgctcgaccggatcatccgcgccgaggtcgac
gccgtcaccttcaccagcgcaccggccgtgtcctcgctgctcagcaccgcgaaagacacc
gaccgggtcgacgccctcctgcacgcgttccacggtcccgtcgcacccgtctgcgtcggt
gccgtgacggcctcgccgctcaccgtcctcggcgtggacaccatgcaacccgcccgcccc
cggctcggcagcctggccaagtacatcatcgaggaactcccgaagcggcggtga

DBGET integrated database retrieval system